SecReT6
Protein ID: 384419454
SecReT6 ID595
T6SS typei3
Gene symbol-
Locus tagXOC_2528
StrainXanthomonas oryzae pv. oryzicola BLS256
Repliconchromosome [GenBank: NC_017267] [Browse all T6SS(s) in this replicon]
Location [Strand]2567491..2570949 [-]
ProductImcF-related family
NoteTssM
UniProt IDG7TGQ2
KEGG IDxor:XOC_2528
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.40E-89, Aligned region: 197..459
IcmF-related [PF06761], Evalue: 2.70E-68, Aligned region: 510..809
DUF1215 [PF06744], Evalue: 6.40E-26, Aligned region: 896..1017
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 65..120
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 117..260
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 318..361
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 544..578
AAA_16 [PF13191], Evalue: 0.0012, Aligned region: 776..857
Protein Sequence: 1152 a.a.     [Download]
>gi|384419454|ref|YP_005628814.1| ImcF-related family [Xanthomonas oryzae pv. oryzicola BLS256]
MRFVLDFLRVRYLASAAILSLLAVLVWVGGPYLSLGRWQPFASVSGRLLAMAVLVLAWAGWRYLRWRRDS
AKQQRLAAELVGQGARAEDASGNDSRARAAQEQVRLRARFTEAMAVLRRRRRNGPGLHVLPWYLLIGAPG
SGKSTLLQSSGLEFPLKAHGTHAALEGVGGTRNCDWWFADQAVFLDSAGRYTTQDSDAIADAGAWHGFLD
LLRRHRRQPLNGVIVTVSVAELLERDGDAGLSHARAVRHRLNELVEKLRARVPVYLIVTKCDLVSGFAEF
FADLDAAGRAQVWGVSFPQAQAAGDTDPLTRFPTELERLLERIDQRVLERLHRARDARERAAVLSFPQQL
RLLQPALMDVVQTAFGRHGYAGQPWLRGVYLSSGTQQGHPIDHVISAVAQHFGVAAAALPPVSSAPRSYF
LSRLLKDVVFAEAGLASSQPGSAQRRRLLQLACWAVLTATTLGVLSGMAGSYARNVRLIGQVRDALDAYP
AGPLPADAGEAAFYAKALQRFDALAQARDAALPPGASIPWSRRFGLHQGMALARDVQEAYLRDLNGALLP
ALAQSLRRKLAQSSNDPQRLYPLLKGYLMLGDPTRRDAMHLATLADTVWRQIFPDDASVRAGLNLHLRAL
LGPVDGARALALDRQQIEQTRASLRTAELPALVYGGLKLTQPGVDAGQAPRLDRRLGLLSDVFERRSGLP
LSAPLPPLFTRQAFQAQIGGGIAHGVQQFLADDWVLGTAPLDPLARSQLEREVLALYQRDYIAAWDSLLA
DLVLRPVVQTGQASAVAAKLGGPASPLKALLVLLREHTHALGRTPAAKAGAGAAAAADTAAADEPDVAAE
PIERHFEPLTRLLDGGPGASALDETLAALTQMSRTLLGAAAGVAADQNAPALLIAAQQAEQLPPPLGNWM
ATLSGRGRALTASSVGEALRNAQRQAAGRECALLVSGRFPFVPGSNNEIPLRDFAELFAPGGRMDRFAQQ
ALLGKVDTSGPGWKWNAGMAAAGADDVLARAQLADEIKQAFFAGGGAQPQVAFTVSIPPQAGIRRLQLEV
DGQALDVRDGARATQSMTWPGPTPGLVRLAAWDASGQALPVVQYRGPWAWFRVMQAGRLHRSGDLDYTAS
LALGDTSVRMDIQPASLRHPFAASAVQRFGCP
 
Nucleotide Sequence: 3459 bp     [Download]
>gi|384417079|ref|NC_017267.1|:c2570949-2567491 Xanthomonas oryzae pv. oryzicola BLS256 chromosome, complete genome
ATGCGCTTTGTGCTCGATTTCCTGCGCGTCCGCTACCTCGCCAGCGCTGCCATCCTCAGTCTGTTGGCCG
TGCTGGTGTGGGTCGGCGGACCCTATCTCAGCCTGGGCCGCTGGCAGCCGTTTGCCAGCGTGAGCGGGCG
CCTGCTTGCCATGGCCGTGCTGGTGCTCGCGTGGGCAGGGTGGCGCTATCTGCGCTGGCGCCGCGACAGC
GCCAAGCAGCAACGTCTGGCCGCCGAACTGGTCGGGCAGGGAGCACGTGCCGAAGACGCCAGCGGCAACG
ACAGTCGCGCGCGTGCAGCACAGGAGCAGGTCCGCCTGCGTGCGCGCTTTACCGAAGCCATGGCGGTGCT
GCGCCGTCGCCGTCGCAACGGTCCCGGCCTGCACGTGCTGCCCTGGTATCTGCTGATCGGCGCGCCCGGT
TCCGGCAAGAGCACCTTGCTGCAGTCTTCGGGCCTGGAGTTCCCCCTCAAGGCACATGGCACCCACGCCG
CGCTGGAAGGTGTCGGTGGCACGCGCAACTGCGATTGGTGGTTCGCCGACCAAGCAGTGTTCCTCGACAG
TGCCGGGCGCTATACCACCCAGGATTCGGACGCCATCGCCGATGCCGGTGCCTGGCATGGCTTTCTGGAC
CTGCTGCGGCGGCACCGCCGGCAGCCATTGAACGGCGTCATCGTGACCGTGAGCGTGGCCGAGCTGCTGG
AGCGCGATGGCGATGCCGGTCTGTCGCACGCGCGGGCAGTACGTCATCGACTGAACGAACTGGTCGAGAA
ACTGCGCGCACGCGTGCCGGTCTACCTGATCGTGACCAAATGCGATCTGGTGTCGGGCTTCGCCGAATTC
TTCGCCGATCTGGATGCCGCCGGCCGCGCGCAGGTGTGGGGGGTGTCGTTCCCACAGGCGCAGGCCGCCG
GTGACACCGATCCGTTGACGCGATTCCCCACCGAGCTCGAACGCCTGCTGGAGCGGATCGATCAGCGCGT
GCTGGAGCGCCTGCATCGGGCGCGCGATGCACGCGAGCGTGCCGCGGTGCTGTCCTTTCCGCAGCAATTG
CGGTTGCTTCAGCCAGCGCTGATGGACGTCGTGCAGACCGCGTTCGGCCGCCATGGCTATGCCGGCCAGC
CGTGGCTGCGTGGTGTCTATCTGAGCTCGGGGACGCAGCAAGGCCATCCGATCGACCACGTCATCTCGGC
AGTGGCGCAACACTTCGGTGTTGCCGCCGCCGCTCTGCCGCCCGTCAGCAGCGCACCACGCAGTTACTTC
CTGTCACGCCTGCTCAAGGACGTGGTCTTCGCCGAGGCGGGACTGGCCAGCAGCCAACCCGGCAGCGCGC
AGCGCCGTCGGTTGCTGCAGCTGGCCTGCTGGGCCGTGTTGACCGCCACCACCCTGGGCGTGCTGTCGGG
CATGGCCGGCAGTTACGCCCGCAACGTGCGGCTGATCGGGCAGGTGCGCGACGCGCTCGATGCCTATCCC
GCCGGCCCGCTGCCCGCCGATGCAGGCGAGGCGGCCTTCTATGCAAAAGCCTTGCAGCGTTTCGACGCGT
TGGCGCAGGCGCGCGATGCGGCGCTGCCGCCGGGCGCGTCGATTCCGTGGTCGCGACGTTTCGGGCTGCA
CCAGGGCATGGCCTTGGCGCGCGATGTGCAAGAAGCGTATCTGCGCGACCTCAATGGCGCGTTGCTGCCG
GCATTGGCGCAATCGCTGCGACGCAAGCTGGCGCAGTCCAGCAACGATCCGCAACGTCTGTATCCATTGT
TGAAGGGCTACCTGATGCTGGGAGACCCGACACGGCGCGATGCAATGCATCTGGCCACGCTGGCAGACAC
GGTCTGGCGCCAGATATTTCCCGACGATGCATCGGTGCGTGCGGGGTTGAACCTGCATCTGCGCGCCTTG
CTGGGTCCGGTGGACGGCGCGCGCGCGCTTGCGCTGGATCGGCAGCAGATCGAGCAGACACGGGCGAGCC
TGCGAACCGCCGAACTGCCGGCACTGGTCTACGGTGGCCTCAAGCTGACGCAGCCTGGGGTCGATGCCGG
CCAGGCCCCACGCCTGGATCGCCGCCTGGGCCTGCTGAGTGATGTCTTCGAACGCCGCAGTGGCCTGCCG
TTGTCTGCGCCATTGCCCCCGCTGTTCACCCGTCAAGCGTTTCAAGCACAGATCGGCGGTGGCATCGCGC
ATGGCGTGCAGCAGTTTCTCGCCGACGATTGGGTGTTGGGCACGGCACCGCTGGACCCGTTGGCGCGCTC
GCAACTGGAGCGCGAGGTATTGGCGCTGTATCAGCGCGACTACATCGCCGCCTGGGACAGCCTGCTGGCC
GATCTGGTGTTGCGGCCGGTCGTGCAGACCGGGCAGGCGAGTGCGGTGGCCGCCAAGCTGGGTGGACCGG
CATCGCCGCTGAAGGCGTTGCTGGTGTTGCTGCGCGAGCACACCCACGCACTGGGGCGCACGCCTGCAGC
GAAGGCCGGCGCGGGCGCTGCAGCTGCCGCGGACACTGCTGCTGCGGACGAGCCGGATGTGGCAGCCGAA
CCGATCGAACGCCATTTCGAACCGCTCACTCGCCTGCTCGATGGTGGGCCGGGCGCCAGTGCGCTGGACG
AAACCCTGGCCGCGCTGACCCAGATGAGCCGCACGCTGTTGGGAGCCGCCGCTGGCGTGGCTGCCGACCA
GAACGCCCCGGCGTTGCTGATCGCCGCGCAACAGGCCGAACAGCTGCCGCCGCCGCTGGGCAACTGGATG
GCGACCTTGTCCGGTCGTGGTCGCGCATTGACCGCCAGCAGCGTCGGCGAGGCATTGCGTAACGCGCAAC
GGCAAGCGGCCGGGCGTGAGTGCGCGCTGCTGGTGAGCGGGCGTTTCCCGTTCGTGCCGGGCAGCAACAA
CGAGATCCCGCTGCGCGATTTCGCCGAACTGTTCGCACCCGGTGGGCGGATGGACCGGTTCGCGCAACAG
GCGTTGCTCGGCAAGGTCGATACCAGCGGGCCTGGCTGGAAATGGAATGCAGGCATGGCTGCGGCTGGCG
CAGACGACGTGCTGGCACGCGCACAACTGGCCGACGAGATCAAGCAAGCATTCTTCGCCGGCGGCGGTGC
GCAGCCGCAGGTCGCCTTCACTGTTTCCATTCCACCGCAAGCAGGGATTCGCCGGCTGCAGCTGGAGGTG
GATGGGCAAGCGCTGGACGTGCGCGATGGTGCGCGCGCCACCCAGTCGATGACCTGGCCTGGTCCAACGC
CCGGTCTGGTGCGTCTGGCGGCGTGGGACGCCAGCGGACAGGCTTTGCCAGTGGTCCAATACCGCGGCCC
CTGGGCCTGGTTTCGGGTCATGCAGGCCGGGCGGCTGCACCGCAGCGGCGATCTGGATTACACCGCCAGC
CTCGCGCTGGGCGACACCAGCGTGCGCATGGACATACAACCGGCCAGCCTGCGGCATCCCTTTGCGGCGT
CGGCCGTGCAGCGGTTCGGTTGCCCATGA
 Primer design