SecReT6
Protein ID: 384422640
SecReT6 ID596
T6SS typei1
Gene symbol-
Locus tagVCLMA_B0108
StrainVibrio cholerae LMA3984-4
Repliconchromosome II [GenBank: NC_017269] [Browse all T6SS(s) in this replicon]
Location [Strand]129845..133390 [+]
ProductIcmF-like protein
NoteTssM
UniProt IDF2ISD1
KEGG IDvcl:VCLMA_B0108
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.90E-93, Aligned region: 509..825
ImcF-related_N [PF14331], Evalue: 4.90E-81, Aligned region: 201..458
DUF1215 [PF06744], Evalue: 2.80E-38, Aligned region: 919..1039
Protein Sequence: 1181 a.a.     [Download]
>gi|384422640|ref|YP_005631999.1| IcmF-like protein [Vibrio cholerae LMA3984-4]
MWKFIVGIVRRLKPTVVAALPILLFTTFILLNVAIWWAGPWLEVAGYKPLESIMARVVASSLFTLGCLAV
WGIWQWRKLQAFKSEQKREEQLRQDPIKVYEQRQEVELNQVMLNMKQSLNKHNYLYALPWYLVLGLENAG
KTSLINRSGQNFVFSSVMRASGQKSENPYSFDWWIGDESVLIDPDGELLTQGNRSEENDGALERRLWLHF
VDWLDRTRSRRPLNGIVLALDVAHLATATASERKAYANLLRARLRELMETLSTRLPVYIALTKLDLLHGF
EPFFKHYTKSQREEVLGFTFSMDSVDNLDSWLEEFASEYTQFVSRVNGMLPHAVAAPMTLEERNAIYSFT
RQISGLKEILQQFFQEALASDQFSTSALVRGAYFTSVYQQGVPTNAFDDAASRRYGLSHAINTAQRAKNS
TVYFTQKLFTHIIYPEAGLASDNFRVAKNKRRLMGLSFVACSVATLLLAGTWHRNYLNNVQHADTVLTKV
NQYKEQFPTSRSLASQREVLDPLNKIREATLEFGFFRDKPQYISDFGLYQGHTIGPKVEETYLNLLETRF
LPLLMADTIVALNQAETDEEKLAVLRVYRMLVDKSGRYQDYVMDYFAKYWQKSFSGQRQIQEELLGHLDY
AMRHTDLTAERLNGDKGAEQVMRPYDKVIARAQVELGSMPNDQRVYRNLKLSAQTVLGPSVNLRSLIGPV
FDVVFEERVLNSSSLFIPQMLTKRGFDDYFMPQSESVSELALIDSWVLGQSKTAQFSEADKQALREKIRD
LYVADYTNTWRAALNEIDVKYFNDINDAVMVLENITSNLEPMQRLLRTLDDNTQLYSALPKDESALKELL
KSPKYKVASMIETPFADLNGMLKPVGSKPAYMTEVLASVDELKSYLKSIQDAPDVGMAALDATKARVKLV
NADPIYTLKRISSGLPKPLDSMMAKLADESWYVVKQEAIKHLEVRWTEDVYKTFQSKLAGRYPFNPASNK
DVALADFEAFFAPNGTLDNFYNQQLKMFIDENISVASDDSAQSIIRKEVLDQIKQAQKIREAFFNRKGIL
DVSFSVEPLSLSNNKRRSVLNVDGQFLAYSHGPRENVELIWPNTLRDSAVSKVTLIPTQTNMSPRSLQIQ
GPWAFFRLLDQGDVVSASQTSVDFKFIVDGGEMIYRINAEADANPFTERLFKSFKLSKTLY
 
Nucleotide Sequence: 3546 bp     [Download]
>gi|384422536|ref|NC_017269.1|:129845-133390 Vibrio cholerae LMA3984-4 chromosome II, complete sequence
ATGTGGAAATTCATTGTTGGAATAGTAAGGCGGCTTAAACCCACGGTGGTGGCAGCACTTCCCATTTTGC
TATTCACTACGTTCATTTTGCTGAACGTTGCCATTTGGTGGGCAGGCCCTTGGTTAGAAGTAGCTGGCTA
TAAACCGCTGGAATCGATCATGGCTCGAGTTGTGGCAAGCAGTCTGTTTACTCTCGGCTGTTTAGCCGTG
TGGGGCATTTGGCAGTGGCGTAAGCTGCAAGCCTTCAAATCGGAACAAAAGCGCGAAGAGCAACTGCGCC
AAGATCCGATCAAGGTGTATGAGCAGCGCCAAGAGGTTGAACTGAATCAGGTGATGCTCAACATGAAGCA
GAGCCTAAATAAACACAACTACTTGTATGCACTACCTTGGTATTTGGTTCTAGGTTTAGAAAATGCGGGT
AAAACCAGCCTGATCAACCGTTCTGGTCAGAACTTTGTCTTCTCTTCGGTCATGCGAGCTTCAGGACAAA
AAAGCGAAAACCCATACTCGTTTGATTGGTGGATTGGTGATGAATCTGTCCTGATTGATCCTGATGGTGA
GCTGTTAACGCAAGGCAATCGTAGTGAAGAGAATGATGGTGCGTTAGAGCGCCGCTTATGGTTGCATTTT
GTCGATTGGCTCGACCGCACTCGTAGCCGCCGCCCGCTAAACGGCATCGTGTTGGCGTTGGATGTGGCGC
ATCTTGCTACCGCCACCGCCTCAGAGCGTAAAGCTTATGCCAATTTGCTGCGTGCTCGTCTGCGTGAGTT
GATGGAAACCTTATCGACTCGTCTGCCGGTGTACATTGCACTGACTAAGCTCGACTTACTGCACGGTTTT
GAGCCTTTCTTTAAGCACTACACCAAAAGTCAGCGCGAAGAGGTGTTGGGTTTTACCTTCTCAATGGATT
CGGTAGATAACCTAGATTCATGGTTGGAAGAGTTTGCCAGTGAGTACACTCAATTTGTGTCACGAGTTAA
TGGCATGCTGCCGCATGCGGTCGCAGCGCCAATGACGCTTGAAGAACGTAACGCGATTTACAGCTTCACG
CGTCAAATCTCAGGTTTGAAAGAGATTTTGCAACAGTTTTTCCAAGAGGCTTTGGCGAGCGATCAATTCT
CAACGTCAGCGCTGGTGCGTGGTGCCTATTTCACGTCGGTTTACCAACAAGGTGTACCTACCAACGCTTT
TGATGATGCGGCTTCCCGTCGTTATGGTCTGTCTCATGCGATTAATACGGCGCAGCGCGCGAAAAACTCC
ACGGTCTATTTCACGCAAAAACTGTTTACCCACATCATTTATCCTGAAGCGGGTTTAGCGTCGGATAATT
TCCGGGTTGCAAAAAACAAACGCCGTTTGATGGGGCTCTCTTTTGTCGCATGCTCAGTGGCGACTTTGCT
GTTGGCGGGAACTTGGCATCGTAACTACCTCAATAACGTGCAACACGCCGATACTGTATTAACCAAAGTG
AATCAGTATAAAGAGCAGTTCCCGACCAGCCGTTCACTGGCCTCACAAAGAGAGGTATTGGATCCGTTGA
ACAAGATCCGTGAGGCGACACTGGAGTTTGGTTTCTTCCGTGATAAACCTCAGTACATCTCCGATTTTGG
TCTCTACCAAGGGCACACCATTGGCCCGAAAGTAGAAGAGACCTACTTAAACTTACTCGAAACTCGCTTC
TTGCCTCTGTTGATGGCGGACACCATTGTTGCGCTCAATCAAGCTGAGACAGATGAAGAAAAATTAGCGG
TGCTGCGTGTGTATCGCATGCTGGTCGATAAAAGTGGTCGTTACCAAGACTATGTGATGGATTATTTTGC
GAAGTATTGGCAAAAATCCTTCTCAGGTCAGCGTCAAATTCAGGAAGAGCTGCTCGGCCACTTAGATTAC
GCGATGCGTCATACGGACCTCACTGCAGAGAGGCTCAATGGTGATAAAGGGGCGGAGCAGGTGATGCGCC
CTTACGATAAAGTGATTGCTCGTGCTCAGGTTGAACTGGGTTCAATGCCAAACGACCAGCGCGTCTATCG
TAACTTGAAATTGAGCGCACAAACGGTGCTTGGTCCTTCGGTTAACTTGCGTAGCTTGATTGGGCCGGTG
TTCGATGTGGTGTTTGAAGAGCGCGTTCTTAACAGTAGCAGCCTGTTTATTCCTCAAATGCTCACCAAGC
GTGGTTTTGATGACTACTTTATGCCGCAATCTGAATCGGTCTCTGAGCTGGCACTGATTGACAGTTGGGT
TCTGGGACAGAGCAAAACGGCACAGTTTAGTGAAGCAGACAAGCAGGCACTGCGCGAAAAAATCCGCGAT
CTTTATGTGGCGGATTACACCAACACATGGCGCGCGGCACTCAATGAAATTGATGTGAAGTATTTCAATG
ACATCAATGATGCGGTCATGGTTTTGGAAAATATCACCAGCAACCTTGAGCCGATGCAGCGTCTACTGCG
CACATTAGATGACAACACCCAACTGTACAGTGCGTTACCTAAAGATGAATCGGCGTTAAAAGAGCTGCTG
AAAAGCCCGAAATACAAAGTGGCTTCGATGATTGAAACTCCGTTTGCTGATCTGAACGGTATGCTCAAAC
CAGTGGGCAGCAAACCAGCGTACATGACGGAAGTCTTGGCTTCGGTGGATGAGCTGAAAAGCTACTTGAA
ATCGATTCAAGATGCTCCCGATGTCGGTATGGCGGCGCTCGATGCGACCAAAGCGCGGGTCAAACTGGTT
AATGCAGACCCTATCTATACCTTAAAACGTATCTCGTCAGGACTGCCGAAGCCGCTGGATAGCATGATGG
CAAAACTCGCAGATGAGAGCTGGTATGTGGTCAAGCAAGAAGCGATCAAGCATCTTGAAGTACGCTGGAC
GGAGGATGTGTATAAAACCTTCCAAAGCAAGCTGGCTGGGCGTTATCCATTCAACCCCGCATCAAATAAA
GATGTGGCCTTGGCCGATTTTGAAGCCTTCTTTGCGCCGAATGGCACGTTAGACAATTTCTACAATCAGC
AACTGAAGATGTTTATTGATGAGAACATCAGCGTCGCGTCGGATGACTCAGCGCAGTCGATCATTCGTAA
AGAAGTGCTGGATCAGATCAAGCAAGCGCAGAAAATTCGTGAGGCTTTCTTCAACCGTAAAGGGATTTTG
GATGTCAGCTTCTCGGTTGAGCCGCTCAGTTTGAGTAACAACAAGCGTCGTAGTGTGCTGAATGTGGATG
GTCAGTTCTTAGCTTACAGCCATGGACCGCGTGAAAATGTGGAGCTGATTTGGCCTAACACGCTGCGTGA
TTCTGCGGTGTCTAAGGTGACCTTGATTCCAACCCAAACCAATATGTCACCGCGCAGTTTGCAAATCCAA
GGACCGTGGGCATTCTTCCGCTTATTGGATCAAGGTGATGTGGTTTCGGCGAGTCAAACGTCGGTTGATT
TCAAATTTATCGTCGATGGCGGTGAGATGATCTACCGCATTAACGCAGAGGCCGATGCCAACCCATTTAC
CGAACGCCTGTTCAAGTCGTTCAAACTGTCTAAAACACTCTATTAA
 Primer design