SecReT6
Protein ID: 384527712
SecReT6 ID561
T6SS typei2
Gene symbol-
Locus tagQ7S_23411
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]140103..143519 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDH8P000
KEGG IDraa:Q7S_23411
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 2.90E-70, Aligned region: 412..725
DUF1215 [PF06744], Evalue: 2.00E-34, Aligned region: 260..296
DUF1215 [PF06744], Evalue: 2.00E-34, Aligned region: 844..964
Protein Sequence: 1138 a.a.     [Download]
>gi|384527712|ref|YP_005418944.1| ImcF domain-containing protein [Rahnella aquatilis HX2]
MTIRSLIGSAFLFLIFIVIVVGGTLTFYPQWVASTFGIGPLSPSGIWTLCLSIAAGLGAVFWLIERMFDR
IGKAGVRIQWRKRKNQQTGAPAVSDTVSPSPSFFTGLDEQMRFRYGRFWRRKVQILWLTGETELVEKIAP
GLTEQNWQEGDDTLLLWGGLPDVPVDPERAIAARLLRPRRPLDGIVHVLEGNQLPGTTSLDETLRQRQKT
DALLGWQAPVYFWVLDRCKWSQEGRETQPVGCLLSGKTSAESVLTALDALIPALREQGMSQLAQDTRYDF
LLRLTERLRKEWRAGLSNVLTTVSRGSSPMMLRGLMFSLPSSAEKGSSHSWEALPEWQGILQDCRNAQGK
RTGWPWEKILQCTLLTLAVVWGAGVLLSLFINQHQIADSHEQAIIAADTTQPLASRLNNQLALQQEIAKL
QYRETAGSPWYTRFGLNQNASQLAALWPLYQANNNVLIRDASATKLKAKLTDFIRLPPGSPQRDALTQQT
YAELKAYLMMSRPDKADATFLSQTLMTLWPKRTGVPDGQWQHVGPKLIAFWGQNLPAHPEWKIAQDKNLV
TAVRQILLKQIGQRNAEASLYQAMLKKVANNYPDMTLTDMVGDTDASYLFNTDEVVPGMFTRQAWEEQVQ
DAIDQVVTTRRNEIDWVLTSKSQPASEDISPEALKARLTERYFTDFSNAWLNMVNSLRWQEPGSLSGAIS
QLTLMADVRQSPMVALMNTLAWQGKTGQKNEALADTLVNSAKVLVGKKQQPVIKQTGGPQGPLDAAFGPL
LTIMDGKSNGVNNGNLSFQAYLTRVTQVRLKLQQVTTAPDPQAMTQMLAQTVFQGKAVDLTDTRDYGSLV
AASLGQEWSGFGKAMFVEPMELAWRQVLQPAAGSLNAQWQSNVVNQWDTSFAGRYPFASTGSDASLPVVA
QYLRSDSGRISQFLKTQLGGILHQEGNRWVPDAITSQGLTFNPAFLDAINQLGQLSDIVFAEGDAGLRFE
LMARPSKNVVRTELAVDGQNLDYFNQMESWQSFKWPGNSYYPGVQLSWRSVSSGMQLFGDFSGNWGLIRL
LEKAQVTQLDSSRYQLVWKTRDGLPLKYILRTEMGNGPLALLALRNFSLPKKVFLDDAPVSSVVAADPGP
VLTDDQDIPAGTGSAGDE
 
Nucleotide Sequence: 3417 bp     [Download]
>gi|384527587|ref|NC_017060.1|:140103-143519 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
GTGACAATCAGATCCCTAATAGGCAGCGCCTTTCTGTTTTTGATTTTTATCGTCATCGTTGTGGGAGGCA
CCCTCACCTTCTATCCACAATGGGTAGCTTCCACCTTTGGCATCGGCCCGTTATCACCTTCCGGTATCTG
GACACTTTGTCTGAGTATTGCCGCCGGGCTGGGGGCGGTTTTCTGGCTGATCGAGCGTATGTTCGATCGC
ATCGGGAAGGCTGGCGTTCGTATCCAGTGGCGTAAACGGAAAAATCAGCAGACAGGGGCACCCGCGGTCT
CAGATACCGTGAGTCCGTCCCCTTCGTTTTTCACCGGTCTGGACGAGCAGATGCGTTTTCGCTATGGCCG
GTTTTGGCGCAGGAAAGTGCAGATCCTCTGGCTGACCGGAGAAACTGAGCTGGTTGAAAAGATAGCGCCA
GGACTGACAGAACAAAACTGGCAGGAAGGTGACGACACCTTGCTTTTGTGGGGCGGCTTACCGGATGTGC
CCGTTGATCCTGAACGTGCGATAGCCGCAAGACTATTGCGTCCGCGCCGTCCGTTAGACGGAATTGTTCA
TGTACTGGAGGGTAATCAGTTACCAGGCACCACCTCACTGGATGAAACCCTGCGCCAGCGCCAAAAAACC
GATGCGCTGCTTGGCTGGCAGGCACCGGTGTATTTTTGGGTGCTCGACAGATGTAAATGGTCACAGGAAG
GCAGGGAAACACAACCCGTAGGGTGTTTGTTATCAGGAAAAACTTCCGCAGAATCTGTGCTTACCGCACT
GGATGCGCTCATCCCTGCGCTACGTGAGCAAGGCATGTCCCAGCTTGCCCAGGACACCCGATATGACTTT
TTATTGCGTCTTACTGAAAGATTGCGCAAAGAATGGCGTGCGGGCCTGAGTAATGTGCTGACCACGGTTT
CCCGGGGTTCCTCTCCGATGATGTTGCGCGGGCTGATGTTCAGTCTGCCATCCAGCGCAGAGAAGGGGTC
TTCACATAGCTGGGAGGCTCTGCCTGAGTGGCAGGGCATTCTTCAGGATTGCCGGAATGCGCAAGGGAAA
CGAACAGGATGGCCTTGGGAAAAAATATTGCAATGCACCCTTCTGACCCTGGCTGTAGTTTGGGGAGCGG
GTGTTTTGCTTTCGCTTTTTATCAATCAGCATCAGATTGCTGACTCTCATGAACAGGCCATTATTGCAGC
CGATACGACTCAGCCCTTGGCCTCACGCCTGAATAATCAGCTAGCACTTCAACAGGAAATTGCGAAATTA
CAGTACCGGGAAACCGCCGGTTCTCCCTGGTATACCCGCTTTGGCCTGAATCAGAATGCCTCACAGCTGG
CGGCACTTTGGCCGTTGTATCAGGCCAACAATAATGTGTTAATCCGGGATGCTTCTGCCACGAAACTTAA
GGCAAAATTAACAGACTTTATCCGGTTGCCACCGGGCAGCCCGCAGCGTGATGCCCTGACACAGCAAACC
TATGCTGAGCTTAAAGCCTACCTGATGATGTCGCGTCCGGATAAAGCCGATGCAACGTTTTTAAGCCAGA
CACTGATGACCCTCTGGCCAAAACGCACCGGGGTTCCGGACGGGCAATGGCAACATGTCGGACCCAAACT
GATCGCCTTCTGGGGGCAGAACCTGCCCGCGCATCCGGAATGGAAAATAGCGCAGGATAAAAACCTCGTC
ACCGCTGTCCGGCAGATCCTGCTAAAGCAAATTGGCCAGCGCAATGCGGAAGCATCGCTGTATCAGGCCA
TGCTAAAGAAAGTGGCAAATAACTATCCGGATATGACCCTGACAGACATGGTGGGTGATACCGACGCTTC
TTATCTGTTCAACACAGACGAGGTCGTGCCGGGAATGTTCACCCGTCAGGCGTGGGAAGAGCAGGTTCAG
GATGCTATCGATCAGGTGGTTACTACCCGACGCAATGAAATTGACTGGGTTCTGACCAGTAAATCCCAAC
CCGCTTCTGAAGACATCTCCCCGGAGGCGCTAAAGGCACGACTCACCGAACGTTATTTCACTGATTTTAG
CAATGCCTGGCTGAACATGGTTAACAGTCTGCGCTGGCAGGAGCCCGGATCTCTTTCGGGGGCTATTTCC
CAGCTCACGCTGATGGCAGATGTACGCCAGTCTCCGATGGTGGCATTGATGAATACGCTGGCCTGGCAGG
GAAAAACGGGGCAGAAAAACGAAGCTCTGGCCGATACGCTGGTGAATTCAGCGAAAGTTCTGGTGGGTAA
AAAACAGCAACCTGTTATTAAACAAACAGGCGGCCCCCAAGGTCCGCTCGACGCCGCCTTCGGCCCCTTG
TTGACCATCATGGATGGCAAAAGTAATGGTGTAAATAATGGCAATCTCAGCTTCCAGGCCTATTTAACCC
GTGTAACACAGGTTCGCCTGAAGCTTCAGCAGGTCACTACCGCACCGGATCCGCAGGCGATGACCCAGAT
GCTGGCTCAAACTGTCTTTCAGGGTAAAGCCGTCGATTTAACCGACACCCGTGATTACGGCAGTCTGGTT
GCAGCCAGTCTGGGTCAGGAATGGAGCGGCTTCGGGAAAGCGATGTTTGTAGAGCCTATGGAGCTTGCCT
GGCGTCAGGTATTGCAACCCGCCGCCGGCAGTCTGAATGCGCAATGGCAAAGTAACGTGGTCAACCAGTG
GGATACTTCATTTGCCGGACGGTATCCGTTCGCCAGCACCGGCAGCGATGCATCCTTACCTGTCGTCGCG
CAATATCTCCGTTCCGACTCCGGACGTATCTCGCAATTCCTGAAAACTCAACTCGGTGGCATTTTACACC
AGGAAGGTAACCGCTGGGTGCCGGATGCCATTACCAGTCAGGGACTGACCTTTAATCCGGCATTCCTTGA
TGCCATCAACCAGTTGGGCCAGTTATCTGACATCGTATTTGCTGAGGGTGATGCAGGATTACGTTTTGAA
TTAATGGCCCGCCCGTCAAAAAATGTCGTCCGCACGGAACTCGCTGTCGACGGGCAAAATCTGGACTATT
TCAACCAGATGGAAAGCTGGCAGAGCTTTAAATGGCCGGGAAATTCCTACTATCCCGGCGTACAGCTCAG
CTGGCGCAGTGTCAGTTCCGGTATGCAACTGTTTGGCGACTTTTCAGGGAACTGGGGATTAATACGCCTT
CTGGAAAAAGCCCAGGTTACCCAACTCGACAGCAGCCGTTACCAGCTGGTCTGGAAAACCCGTGATGGTC
TGCCATTGAAATACATACTGAGAACAGAAATGGGCAATGGACCGCTGGCATTGCTGGCTTTACGTAACTT
CTCTTTGCCCAAAAAAGTATTTTTAGATGATGCGCCTGTCTCTTCTGTCGTTGCCGCCGATCCCGGACCC
GTACTGACAGACGATCAGGATATCCCCGCAGGAACGGGCTCTGCCGGAGATGAGTAA
 Primer design