SecReT6
Protein ID: 384528059
SecReT6 ID563
T6SS typei4b
Gene symbol-
Locus tagQ7S_25186
StrainRahnella aquatilis HX2
Repliconplasmid PRA1 [GenBank: NC_017060] [Browse all T6SS(s) in this replicon]
Location [Strand]513583..517020 [+]
Producthypothetical protein
NoteTssM
UniProt IDH8P0R6
KEGG IDraa:Q7S_25186
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 7.00E-29, Aligned region: 184..343
ImcF-related_N [PF14331], Evalue: 7.00E-29, Aligned region: 350..370
ImcF-related_N [PF14331], Evalue: 7.00E-29, Aligned region: 768..806
ImcF-related_N [PF14331], Evalue: 7.00E-29, Aligned region: 1096..1137
Protein Sequence: 1145 a.a.     [Download]
>gi|384528059|ref|YP_005419291.1| hypothetical protein Q7S_25186 [Rahnella aquatilis HX2]
MFKKLLSFVAWTLFLCLLLIVCIVMSVVFEQTLLHALILWLILILAVLFSRFVWGSVSGMAQAKYISSLK
ARFKLTRLEYVLFEHWKTGAAVIKRIRRRKQPIPWFILTGGRSGKTTLMAGAGLPLFSNEPESSLVVPTR
TLRWWFFRSAGFLDLSSHFLNKTPAFERGWLRLVNRCARLPAPGGIVVCVSVSELLEKDDAELHLHARHI
RTQIEPLVSKVKRRLPVYLFITCCDRVPGFSHWANNLSAEQRQQPLGYYWRRSPVVDGKDPALLDPLFTC
VKDGLDKVRVSMLSGGEPDGDTLALMDFPEQLPKLQPALQRYLAALCEPDAYFQPAALGGIWFPATEPVS
KNSASRQAFFIHDLMARLLPELSRQREIEPVGFGRRYLHKWGAMTFSVLAITYVLFSGYFTNRLTGGSPA
QMDVTAQVQQLENIEHWNAHPLKYLPFVPVLNHRHTQLEASILAASPRDKVNLREIADNYQQLFTDADPQ
QKRELILNLASTLITKQAMWEKQPVSELIKQAPVPAALSMTGATVSLPYQQDVVLQRALLQLPEGGKQLV
VLRELLGRLVNSDPQMAWLVAPSGDLTPVNLTDFMPSSEDQTQVSGLWTLQGTAQIQGWLKEIRRAGGEQ
VPMPALVAFEQHWPALRQTQWMTMMLAMNQQPAPELTSEEWQTALITLDQGNSPSMKFSRYVNEQLEDIR
AQDAEPWLRELRRLNQLQAMSVPGALIPRISKVQQSFQKKISALLKIDSKTLTPVLSDLNVKNWNAWKNS
LHAAVSDVFATPKSSDRLTRGLFQTGAAGDSNPLQLLDSRFNVLRKNLSAERDDFASNAVWALYQNDAHW
LVAHAMQRSACWLEQQWQSRVLWPMENNASRLEYDDQQDLAWQYLSDFIRGPAKSVLVVEDNGPKAGEFN
GQTPGLTPEFLRMVNHVLRPDDVLAMPERENTRNDDALAALKDEQADLEAQMAALEAKPLELTLKSLPAT
IPGGARLMPVGTQLTLFCDEQQWKLNSMNFSEQAAFRWRPGHCSRATLVIKFPGFDLTYEYFGDAAWPDF
LQDISDGQHRFKAEDFPDDAAQLTALGIKEVMVRYQSGSQNAVQDRWHQWQELNQALNDNAEAQQETGLK
KAEKQRPTALKSAFSQLPVRITGCH
 
Nucleotide Sequence: 3438 bp     [Download]
>gi|384527587|ref|NC_017060.1|:513583-517020 Rahnella aquatilis HX2 plasmid PRA1, complete sequence
ATGTTTAAAAAATTACTTTCCTTTGTCGCATGGACACTATTTCTGTGCCTGTTACTTATTGTTTGTATTG
TCATGTCTGTTGTTTTCGAACAAACACTCCTGCATGCATTAATTTTGTGGCTGATATTGATCCTCGCCGT
TTTATTTTCCCGGTTTGTCTGGGGATCTGTTTCCGGTATGGCGCAGGCGAAATATATCTCCTCCCTGAAG
GCAAGATTTAAACTCACCCGGCTGGAATATGTTTTATTCGAACACTGGAAAACCGGGGCTGCGGTAATTA
AGCGCATCAGAAGACGCAAACAGCCAATACCCTGGTTTATACTCACTGGCGGGCGAAGTGGTAAAACGAC
GCTGATGGCCGGTGCAGGATTACCGCTGTTTTCTAATGAACCGGAAAGTTCTCTGGTTGTGCCGACCCGC
ACCTTACGCTGGTGGTTTTTTCGTTCCGCAGGTTTTCTCGACCTCTCCAGCCATTTTCTGAATAAAACCC
CGGCCTTCGAGCGCGGCTGGTTGCGTCTGGTGAACCGGTGTGCCCGTCTGCCTGCGCCGGGTGGCATCGT
GGTGTGCGTGTCGGTCAGTGAGTTGCTCGAAAAAGATGACGCGGAACTGCATCTGCATGCGCGGCATATC
CGCACGCAGATCGAACCGCTGGTCAGTAAAGTCAAACGCCGTCTGCCGGTGTATCTGTTTATCACTTGTT
GTGACCGGGTGCCCGGTTTCAGCCACTGGGCCAATAATCTCTCCGCCGAACAGCGCCAGCAACCGCTGGG
TTACTACTGGCGCCGTTCGCCTGTCGTCGACGGGAAAGATCCGGCCTTGCTGGATCCGCTGTTTACGTGC
GTGAAAGACGGGCTGGATAAAGTGCGTGTCAGCATGCTTTCGGGCGGCGAACCGGATGGCGACACGCTGG
CGTTGATGGATTTCCCTGAACAGCTACCGAAATTGCAACCTGCACTGCAACGTTATCTGGCCGCCCTGTG
TGAGCCGGACGCTTACTTTCAGCCCGCAGCACTGGGTGGTATCTGGTTTCCCGCCACTGAACCTGTCAGC
AAAAACAGTGCTTCGCGTCAGGCTTTCTTTATCCATGACCTGATGGCCCGATTACTGCCTGAACTAAGCC
GCCAGCGTGAAATTGAGCCTGTCGGGTTTGGCCGTCGCTATCTGCATAAATGGGGGGCGATGACCTTCAG
TGTGCTGGCAATAACCTATGTGCTGTTTTCCGGTTATTTCACCAACCGCCTCACCGGGGGCTCGCCCGCG
CAAATGGATGTCACGGCGCAGGTTCAGCAGCTTGAGAACATTGAACACTGGAATGCACATCCGCTGAAAT
ATTTACCTTTTGTTCCCGTTCTCAACCATCGCCATACGCAGCTTGAGGCCAGCATTCTTGCTGCATCCCC
ACGCGATAAGGTGAACCTGCGGGAGATAGCAGATAACTACCAGCAGCTGTTCACCGACGCCGATCCACAG
CAAAAACGCGAGTTGATTCTGAACCTGGCAAGCACGCTTATCACTAAACAGGCCATGTGGGAAAAACAGC
CGGTCAGTGAGCTGATAAAACAGGCGCCGGTTCCGGCGGCGCTGAGCATGACCGGGGCCACCGTGTCCTT
ACCCTATCAACAGGATGTGGTGTTGCAACGCGCGCTGTTACAGTTGCCGGAAGGCGGCAAGCAACTTGTG
GTACTGCGCGAATTGCTCGGACGTTTGGTCAACAGTGATCCGCAGATGGCATGGCTGGTGGCTCCTTCAG
GCGATCTGACGCCAGTGAATCTGACGGATTTCATGCCCTCGTCTGAGGATCAAACGCAGGTCAGTGGTCT
GTGGACGCTACAGGGCACCGCACAAATTCAGGGCTGGTTGAAGGAAATCCGTCGCGCAGGAGGTGAACAG
GTCCCGATGCCTGCGCTAGTGGCTTTTGAACAGCACTGGCCTGCGCTGCGCCAGACGCAATGGATGACGA
TGATGCTGGCGATGAACCAGCAACCCGCCCCGGAGCTGACCAGCGAAGAGTGGCAAACCGCGCTGATTAC
GCTCGATCAGGGTAACAGCCCATCAATGAAATTTTCCCGTTACGTCAATGAACAACTAGAAGACATCCGT
GCTCAGGATGCCGAGCCCTGGTTGCGCGAGCTGCGCCGGTTGAATCAGTTACAGGCTATGTCGGTACCCG
GTGCGCTGATACCGCGTATCAGCAAGGTCCAGCAGTCTTTTCAGAAGAAAATTTCAGCACTGCTGAAAAT
CGACAGCAAAACCCTGACACCCGTGCTTTCCGATCTCAATGTGAAAAACTGGAATGCCTGGAAAAACAGT
CTGCATGCGGCGGTTTCGGACGTGTTTGCTACGCCGAAAAGCAGCGATCGTCTGACGCGCGGACTGTTCC
AGACCGGCGCGGCGGGCGACAGCAATCCACTGCAATTACTCGACAGCCGTTTTAACGTGCTGCGTAAGAA
CCTGTCGGCGGAACGCGATGATTTTGCCTCCAACGCGGTGTGGGCGTTGTATCAGAATGATGCGCACTGG
CTGGTGGCGCATGCCATGCAGCGTTCTGCCTGCTGGCTTGAACAGCAATGGCAGAGCCGGGTGCTGTGGC
CAATGGAAAATAATGCCAGCCGTCTGGAGTACGACGACCAACAGGATCTGGCGTGGCAATACCTGTCTGA
CTTTATCCGGGGACCGGCAAAAAGTGTGCTGGTGGTTGAAGATAACGGGCCAAAAGCGGGCGAATTCAAC
GGGCAGACACCGGGCCTGACACCGGAATTTCTGCGAATGGTCAATCACGTGTTGCGTCCGGATGACGTGC
TGGCGATGCCGGAACGTGAAAATACCCGCAATGACGATGCGCTGGCCGCCCTGAAAGATGAGCAGGCCGA
TCTGGAGGCTCAAATGGCGGCACTGGAAGCAAAACCGCTGGAACTGACGCTTAAAAGCCTGCCTGCCACC
ATTCCCGGCGGTGCGCGGCTGATGCCGGTGGGCACTCAGTTGACGCTGTTCTGCGATGAGCAACAGTGGA
AGCTCAATAGCATGAACTTCAGCGAACAGGCGGCATTCCGCTGGCGTCCGGGGCATTGCAGTCGTGCCAC
GCTGGTGATCAAGTTCCCTGGTTTCGATCTGACGTACGAATACTTCGGCGACGCCGCATGGCCTGATTTC
CTGCAGGACATTTCCGACGGGCAGCATCGTTTCAAAGCGGAAGATTTCCCGGATGATGCCGCTCAGCTGA
CGGCACTGGGCATCAAAGAAGTCATGGTGCGTTATCAGAGCGGCTCACAGAACGCGGTGCAGGATCGCTG
GCATCAGTGGCAGGAACTCAATCAGGCACTGAATGACAACGCTGAGGCGCAGCAGGAAACCGGCCTTAAA
AAAGCGGAAAAACAACGACCGACAGCGCTGAAAAGTGCGTTCTCGCAACTGCCTGTCCGCATTACCGGAT
GTCACTGA
 Primer design