SecReT6
Protein ID: 385237026
SecReT6 ID599
T6SS typei4b
Gene symbolicmF
Locus tagABTW07_1475
StrainAcinetobacter baumannii TCDC-AB0715
Repliconchromosome [GenBank: NC_017387] [Browse all T6SS(s) in this replicon]
Location [Strand]1587719..1591543 [+]
Producthypothetical protein
NoteTssM
UniProt IDF0QL85
KEGG IDabd:ABTW07_1475
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 4.30E-72, Aligned region: 188..451
IcmF-related [PF06761], Evalue: 2.40E-52, Aligned region: 462..483
IcmF-related [PF06761], Evalue: 2.40E-52, Aligned region: 496..837
DUF1215 [PF06744], Evalue: 4.30E-25, Aligned region: 774..798
DUF1215 [PF06744], Evalue: 4.30E-25, Aligned region: 968..1080
Protein Sequence: 1274 a.a.     [Download]
>gi|385237026|ref|YP_005798365.1| hypothetical protein ABTW07_1475 [Acinetobacter baumannii TCDC-AB0715]
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALASAYALGLIAYGIYWLIQRKKHAVQGEE
LAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAALYELPWYMVIGNPAAGKSSAI
YNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDTAGRYSVYSEDHSEWLGFLNILKKNRSKAPV
NGLILIVSIAELVSQSPEHSLKLAKNLRARIQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYN
QAWGATLPYEQNSSHNAVDLFEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFI
ATLFEDNPYQFQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNKVVQLEKSSGQ
QLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLKGVKQIVLIPTQQNIAQYLQR
VKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNALKAYLMMSNPQYMDASHLSDQVTRFWRSWL
DANKGQMPRADMIQEAEQILSYAMTLANDKQFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRA
AVRFPALTVNQIVGDANKNIVLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFS
GSPEQIRKQLTALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRMLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQGKSLLDEYMT
NLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAVGFSEIDQQLLQKLVVSPLTQ
AFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSASLQATSSEIGQILGENGSISRFVKESLDPFV
IRRGYTLTSKTWKDLGISLNPQFVMNFQRYVAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSY
TVDIDGQRMTYENGVQQWVNFIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGG
FEMLWRSKTDPSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTEN
PVSALAQPAAGVKP
 
Nucleotide Sequence: 3825 bp     [Download]
>gi|385235550|ref|NC_017387.1|:1587719-1591543 Acinetobacter baumannii TCDC-AB0715 chromosome, complete genome
ATGCATACAATTTTAGGCTACTTGTGGCAGTACATCACGAATCCTAAAGCAATTATCGCCTTGTCATTGT
TCGTGGCATTGATGTCTTCCTATACTTCAATTCCTCGCCATATATTTTGGGCTTTAGCATCTGCATATGC
TTTAGGGCTCATCGCTTATGGAATTTATTGGCTAATTCAGCGTAAAAAGCATGCTGTTCAAGGTGAAGAG
CTTGCACAAGCGATTGAAAAGGATACCCAAGCAGAGTACGGCAAAAATAAAGATAAAGAAGAGCTGCAAC
TTATTAGCCAACAAATGAAAGAATCTATTCAATTGATTCGTAAGTCAAAGTTAGGCGATAAAAAGGGGAA
CGCAGCACTATATGAGTTGCCATGGTATATGGTCATTGGTAACCCAGCTGCTGGTAAAAGTTCTGCGATC
TATAATTCTGGTTTAAAGTTTCCTTTTGAAGAAACCCATCAAAAAATGGTTTCGGCTGGTTTAAGCGGTA
CGCGTAATTGTGACTGGTTTTTTTCGACTGAGGGTATTTTACTCGACACCGCTGGACGTTATTCGGTCTA
TAGCGAAGACCACTCTGAATGGTTAGGCTTTTTAAATATCTTAAAGAAGAACCGTTCTAAGGCTCCAGTA
AATGGTTTAATTCTTATTGTTAGTATTGCTGAGCTTGTTAGTCAGAGTCCTGAACACTCATTAAAGCTTG
CGAAAAATTTACGCGCTCGTATTCAGGATTTAACCGAACGTTTAGAAGTGGTTGTACCCGTATATCTAGT
CTTTTCAAAAATGGATTTGATCGCGGGTTTTACCGAATTTTTCGAATTCTATGAAGCACAAGAATATAAT
CAGGCGTGGGGCGCAACACTACCATATGAGCAAAACTCTTCTCATAATGCTGTAGATCTTTTTGAGAAAC
ACTACAATATTCTTTATGACGGTTTAAAAGGGGTCAGTTCAACTCATCTTAGCCGTCGACATTCTCAAAA
TATCTCACCTAGTGTGATGACTTTCCCATTAGAATTTAAGACATTAAAACCTGCATTAAAAAGTTTTATT
GCGACATTGTTTGAAGATAACCCTTACCAGTTCCAACCAGTTTTCCGTGGGTTTTATTTCACAAGTGCTT
TGCAAGAAGGCGTAATAGAAAGTCCAATGACTGAGCAAATTGCACAGGAATTCCAGCTTTCCCAAATTGC
TCAAAGTGAAGTAAAAGATCAGCTAAAAACAACGCCTAACCATGGTTATTTCTTAAAAGGCTTGTTTTCA
GATGTCATTTTAAAAGATAAAGATCTGGTTAAACAGCATGTCAATACAAGCAAAAAGCGTCAGCGTTATA
TTGCATTTATTGGTGCTTTAGCAGGCGTATCCATTATTCTCGGTGTGTGGGTTTGGTCATATCGTAATAA
TCAACAACTTATTGCCGAAGTTCAAGCTGATTTGAATAAAGTTGTTCAATTGGAAAAGAGTTCAGGTCAA
CAATTGTCGACTCAATTAGAGGCCTTACTTATCTTGCAAAGACGTCTACAACAGTTAGACGAATTTGATG
AAAATAGACCACTAAAATTTAGTTTTGGTTTATATCAAGGTAATGAGCTACGTGAAAAATTAAAAGCTGA
ATATTTAAAAGGTGTTAAGCAAATTGTTTTGATACCTACACAGCAAAATATTGCTCAGTATTTGCAACGT
GTAAAAAATAACGAAGCAACTTTAAAAGCAAATCATACCAATGTTGAGATCAAGCAAACTGCTCAAACTC
AGCAATATTTAGAGCCTTCGGATACCAACCCTCAAGATGCTTATAATGCTTTAAAAGCATATTTAATGAT
GAGCAATCCACAGTATATGGATGCAAGTCACTTAAGTGATCAGGTAACGCGTTTCTGGCGTTCTTGGCTT
GATGCCAATAAAGGGCAGATGCCACGTGCAGATATGATCCAAGAAGCTGAGCAGATCTTATCTTATGCAA
TGACATTGGCAAATGATAAACAATTCCCGATCTTGGATGCTGACTCTCAACTCGTGGATCAGACACGTCA
AGTATTGCTCTCTGTTATTAGAGGTATGCCAGCACGTGACCGTGTTTATAATGAAATTAAAATGCGTGCT
GCTGTGCGCTTTCCAGCTTTAACTGTAAACCAGATTGTAGGTGACGCAAATAAAAATATTGTATTGGGTA
GTTATGCATTACCAGGGGTATTTACTCAAAAAGCTTGGAACGAGTATGTAGAAAAAGCAATTGAGGAAGC
AGCAGACAAACCTACGGATACTAAAGACTGGGTGCTTAATAGCCGTCAATCTGATGATTTAACTTTCTCA
GGTAGTCCAGAGCAAATCAGAAAGCAGCTTACTGCATTGTATAAACAAGAATATATTGCAGAGTGGAGAA
AATTCTTAAGTGGCATTCACTATGCAAAAGCAACTCAGTTTGCTCAGCAAGTTAAAAATATTGATGTATT
GGGCGAACCACAAAATTCACCAATTCGCATGCTTATTGAACGCGTAGCCATTGAAACAAACTGGGATAAT
CCGGTTGTTCAAGCAGAGTTAGCAGCGCCTCAAAAAGGATTTATTGCATGGTTTAAACGTAAGGTTTTAA
ACCATGATGATAAACAATTAGCAAATCAGGCTGTAACGAATGCTCAAGGGCCTATTTCTCAAGAATATCA
AATGTTCTATCAATTGGTTCGTAAACGTGATGATCAGCAAGGTAAATCTTTGCTTGATGAATATATGACG
AATCTTGCCTTAGTACGTAGTAAGTTTAATGAACTTAAGAATGCGGGTGAGATCGGACCGAATGCGATGA
CATTGGTTAAGCAAACTTTAAATGAGCAGACATCGGTATTTAACCAGACTCAAAAAATTGTAGATGAAAA
GATGGCGGTTGGTTTCAGTGAAATTGATCAGCAACTTCTACAAAAATTAGTGGTGAGTCCACTTACCCAA
GCCTTTGAAAGTTTAATTACACCTACTCAAGATGAAATTAATAAGCTATGGGTAATGCAAGCCTATCAAC
CATTTACTGCAAATCTTGCTAAGAAATATCCATTTAACTCATCAGCTTCTTTACAAGCAACAAGTAGTGA
AATTGGACAAATTCTTGGTGAGAACGGCAGTATTTCCCGTTTTGTTAAAGAGAGTTTAGACCCGTTTGTT
ATCCGCCGCGGTTATACCTTAACCTCCAAAACATGGAAAGATTTGGGGATTAGTTTAAACCCACAATTTG
TTATGAACTTCCAACGCTATGTTGCACCTACAAATGGAATGGCAACAGGTGAGTTAAATAGCCAAGCACC
AGCTGCTCCGGCAACTAATCAGTCTAACTTCCAGTTCTACCCAATTCAAAACCCGCAGTTACTTTCATAT
ACCGTTGATATTGATGGTCAGCGTATGACTTATGAAAATGGGGTGCAGCAATGGGTTAACTTTATTTGGC
CAAATCAAGGCAGTATTCCGGGTGCTCGTATTACGGCTGTAGATTTACAAGGTCAAACACATACCATTTT
TGATGAACCAGGCGAATACGGGATTAACCGTTTAATCGATAGTGCACAGCGTAAAGAGCAAAACGGTGGT
TTTGAAATGCTTTGGCGCAGTAAGACAGATCCATCACTCTTTGTGAAAATGAACTTCCGTCTTATTAGTA
GTAATTCAGGAAGTATCGGTTCAAGCCGTGGCTACTCTGGTATGCAACTGGTTGACAAAGTAACTGCGGA
TAAGGCTGCTCGCGTTGTATCCGCACAGCAAGCACCAGCTCAGGCAGCTGCTCCTGCCAAAACTGAAAAT
CCAGTTTCTGCACTAGCACAACCTGCTGCGGGAGTTAAGCCATGA
 Primer design