SecReT6
Protein ID: 385333204
SecReT6 ID604
T6SS typei1
Gene symbol-
Locus tagHP15_3463
StrainMarinobacter adhaerens HP15
Repliconchromosome [GenBank: NC_017506] [Browse all T6SS(s) in this replicon]
Location [Strand]3646015..3649608 [-]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDE4PFF6
KEGG IDmad:HP15_3463
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.70E-91, Aligned region: 184..215
IcmF-related [PF06761], Evalue: 1.70E-91, Aligned region: 512..839
IcmF-related [PF06761], Evalue: 1.70E-91, Aligned region: 931..954
ImcF-related_N [PF14331], Evalue: 1.70E-78, Aligned region: 101..122
ImcF-related_N [PF14331], Evalue: 1.70E-78, Aligned region: 201..463
DUF1215 [PF06744], Evalue: 2.20E-35, Aligned region: 934..1055
Protein Sequence: 1197 a.a.     [Download]
>gi|385333204|ref|YP_005887155.1| type VI secretion protein IcmF [Marinobacter adhaerens HP15]
METMWRKALLIGRWLLPYLKNAAPVTLTLGVIALLVATWWLGPRWELSGEFPLAAWQMRALVTLGVVLVV
AMMWGMVLARRLRKMNVQQAEVQKEQEDPILPMERKQQRLLDRQLAALKSNLPGRKGIYRLPWYLVMGLE
DAGKTSLIQRSGQTYTLTNVTRNNRVDRNAFGFDWWIGDEGVLIDPDGELLSQSQGEGAGAEIQQRLWNH
FIAWLERNRPQRPLNGVVLAIDVASLSVADPGQRRDRAILLRTRLRELMEQIGSRLPVYVTFTKMDLLYG
FGPLVRTLSKQETEQALGFTFSLEGQMDNDDWLHQFADRYTAMVERLTDRLPDVLANTRDAEERAAAYSF
TRQLAGLKPVLEHFLTDLLSADVFSTPAMVRGTYFTSVLQEGVPEDAFVSAAAANYQIAGPIQPAQRTGQ
SAALFTRALFSQIIYPEAGLAGDNRRVIQSRQRRLAVAAVVAICAGAGMTAGWQHFFIKNAEAATAVETR
VKGFIDHWQPVGFEPDNTGRNLLGPLDELREATLAFGDYRRNWPLFSDMGLYRGHEVGPEVEESYLDMLA
YQYLPALMFGVMAEMGQAPDNSTERLEHLRVLRMLYDASGRRDDIVTRYMQHHWQEAFPGQSELQQRLLG
HLDYAMAHTDLAQLTRQGDAVADMTLAPFRSSVEWAQHELGRIATPDRVYKDLEIEAEQEFRAPLELARA
SGPAFSTVFTRVDGYGEPSQSEAAVEEDPLTIPALLTREGLEKWFLRKSGSVTELALVDAWVLGRRDNVD
FSKADEARLLASLQTLYAEHYAEAWRSALSRIDIQRFEDLNHGVRILESLTSGHEPLASLLGHVRHNTLL
VPSEEGESAAARELLEQSPHFRMLQDIERQFAELNQLTRENGDQATGLEQIMLVVGELHEYMRNIQEAPD
KGKAALAAARARMGLQGADPIFTLQRMADNQPEPLNRLLTRLAMESWRVVLDQAVAQLEREWYREVYQPF
QQNLARHYPFNPDSGRDVALQDFERFFSPGGILDAFYQDNLKLFLEDHPEQVGDARRAGLVRGAVLTSLE
NADRIRRAYFTRGGSLDVEFALEPLNLSANKRRSVVNVDGQLVEFSHGPRQSIPLVWPNTLRDSVESRIT
LVPVQVNRSPRSLSESGPWALFRLLDSAEITGVSSSAVDVRFRVDDGEMRYRLHAASNTNPFTQQLLAGY
RIPRSLY
 
Nucleotide Sequence: 3594 bp     [Download]
>gi|385329741|ref|NC_017506.1|:c3649608-3646015 Marinobacter adhaerens HP15 chromosome, complete genome
ATGGAAACCATGTGGAGAAAAGCTTTACTCATCGGTCGCTGGCTTTTGCCATACCTCAAAAATGCAGCCC
CGGTCACGCTGACACTGGGCGTTATCGCCTTGCTGGTGGCCACCTGGTGGCTGGGGCCCCGCTGGGAGCT
GAGTGGTGAGTTTCCATTGGCGGCCTGGCAGATGCGGGCCCTCGTAACCCTGGGCGTTGTCCTAGTGGTC
GCGATGATGTGGGGCATGGTGCTGGCGCGCCGCCTGCGCAAGATGAATGTCCAGCAGGCCGAAGTGCAGA
AAGAACAGGAAGATCCGATTCTGCCGATGGAGCGCAAGCAGCAGCGCCTGCTGGATCGTCAGCTGGCGGC
CCTGAAAAGCAACCTCCCCGGCCGCAAAGGCATTTACCGGCTGCCCTGGTACCTGGTGATGGGCCTGGAG
GATGCTGGCAAGACCAGCCTGATTCAACGCTCCGGGCAGACCTACACGCTCACCAACGTAACCCGCAACA
ATCGGGTGGATCGCAATGCCTTCGGTTTTGACTGGTGGATCGGCGATGAGGGTGTCCTTATCGATCCGGA
TGGTGAACTGCTGAGCCAGAGTCAGGGTGAGGGTGCCGGTGCGGAGATCCAGCAGCGTCTTTGGAATCAT
TTCATTGCCTGGCTTGAGCGAAATCGCCCGCAACGCCCCCTCAATGGTGTGGTGCTGGCCATTGATGTGG
CCAGTCTCAGCGTGGCAGACCCCGGCCAGAGGCGGGACCGTGCCATCCTGTTACGGACGCGCCTGAGAGA
ATTGATGGAGCAAATCGGCTCCCGCCTGCCCGTTTATGTCACTTTCACCAAGATGGACCTGCTCTACGGT
TTTGGCCCGCTCGTGCGGACCCTGAGCAAGCAGGAGACGGAACAGGCCCTTGGCTTTACCTTCAGCCTCG
AAGGCCAGATGGATAACGACGATTGGCTGCACCAGTTCGCGGACCGATACACCGCCATGGTTGAGCGGCT
TACCGATCGCTTGCCGGATGTTCTGGCCAATACCCGGGACGCCGAGGAGCGGGCAGCAGCCTACTCTTTT
ACTCGCCAGCTTGCTGGCCTCAAGCCTGTTCTGGAGCATTTCCTGACCGATTTGCTGTCTGCGGATGTGT
TCTCGACACCTGCGATGGTTCGCGGCACCTACTTCACCTCGGTGTTGCAGGAGGGCGTTCCGGAGGATGC
CTTTGTCTCGGCAGCCGCCGCCAACTATCAGATTGCCGGGCCCATTCAGCCTGCTCAACGGACAGGGCAG
TCCGCTGCCCTGTTTACCCGGGCACTGTTCTCCCAGATCATCTATCCGGAGGCGGGCCTGGCCGGTGATA
ACCGACGGGTGATTCAGTCCCGGCAACGGCGGCTGGCCGTGGCCGCCGTGGTGGCCATTTGTGCCGGTGC
GGGTATGACCGCCGGCTGGCAGCATTTTTTTATCAAGAATGCAGAGGCCGCGACCGCCGTCGAAACCCGT
GTTAAGGGGTTCATCGATCACTGGCAGCCGGTGGGCTTTGAACCGGATAACACCGGACGGAATTTGCTCG
GCCCGCTGGATGAACTTCGTGAGGCGACCCTGGCCTTTGGCGATTATCGCCGGAACTGGCCGTTGTTCAG
TGATATGGGCCTGTACCGTGGCCATGAGGTTGGCCCGGAAGTAGAAGAATCCTATCTGGATATGCTGGCA
TACCAGTATTTGCCAGCCCTGATGTTCGGTGTGATGGCCGAGATGGGCCAGGCGCCGGACAACAGCACTG
AGCGTCTGGAGCACCTGCGGGTGTTGCGTATGTTGTATGACGCCAGTGGTCGTCGCGACGATATTGTTAC
CCGCTACATGCAGCACCACTGGCAGGAGGCGTTCCCCGGCCAGAGTGAACTGCAGCAGCGGCTACTGGGT
CATCTGGACTATGCCATGGCGCATACCGATCTAGCACAGCTCACTCGCCAAGGCGATGCAGTTGCCGATA
TGACTCTGGCGCCGTTTCGTAGCAGCGTCGAGTGGGCACAACATGAGCTTGGTCGGATTGCTACGCCAGA
CCGGGTCTATAAGGATCTGGAAATTGAAGCAGAACAGGAATTTCGGGCACCTTTGGAACTGGCCAGGGCA
TCCGGGCCGGCATTCAGCACGGTGTTCACTCGGGTGGATGGGTATGGCGAGCCGTCCCAATCTGAGGCAG
CGGTCGAGGAAGACCCATTGACTATCCCCGCGTTGCTGACCCGGGAGGGGCTTGAGAAGTGGTTCCTGCG
CAAGTCCGGCTCGGTAACGGAGCTGGCCCTGGTAGACGCCTGGGTGTTGGGCCGCCGGGACAACGTCGAT
TTTAGCAAGGCGGATGAAGCCAGGCTGTTGGCCAGTTTGCAGACCCTTTATGCCGAGCACTACGCCGAGG
CCTGGCGTTCTGCCTTGAGCCGCATCGATATTCAGCGGTTTGAGGACCTGAACCACGGCGTGCGCATTCT
CGAGAGCCTGACCAGCGGCCACGAGCCCTTGGCAAGCTTGCTCGGGCATGTTCGCCATAACACGCTTCTT
GTGCCTTCGGAAGAAGGGGAGAGTGCCGCAGCTCGTGAGCTTCTGGAGCAGTCACCCCATTTCCGCATGC
TGCAGGATATTGAACGCCAGTTTGCGGAGCTCAACCAGTTGACTCGGGAAAATGGAGATCAGGCAACCGG
GCTTGAGCAGATCATGCTGGTGGTCGGGGAACTTCACGAGTACATGCGCAACATCCAGGAAGCGCCAGAC
AAGGGCAAGGCTGCGTTGGCTGCTGCCCGGGCCCGCATGGGCCTGCAGGGTGCCGACCCGATCTTCACCC
TGCAGCGCATGGCCGATAATCAGCCGGAGCCTCTAAACCGGCTTCTGACCCGGTTGGCCATGGAAAGCTG
GCGAGTAGTTCTGGACCAGGCAGTGGCGCAGCTGGAGCGTGAGTGGTATCGCGAGGTATATCAGCCTTTC
CAGCAGAATCTGGCCCGACACTACCCGTTTAATCCGGATTCAGGGCGGGATGTTGCACTGCAGGACTTCG
AACGCTTCTTTTCCCCGGGCGGGATTTTGGACGCCTTCTATCAGGACAACCTGAAACTGTTCCTCGAGGA
TCACCCGGAACAGGTGGGCGATGCTCGACGTGCCGGCCTGGTGCGCGGAGCGGTACTGACTTCCCTGGAA
AATGCCGACCGAATCCGCAGGGCCTACTTTACCCGGGGTGGTTCCCTGGATGTGGAGTTTGCCCTGGAAC
CGCTCAATCTCTCAGCCAACAAACGCCGCAGCGTGGTTAACGTGGACGGCCAGCTGGTGGAGTTCAGCCA
CGGCCCGCGCCAAAGCATTCCGCTGGTCTGGCCGAATACCCTTCGGGACTCTGTGGAGAGCCGTATTACC
CTGGTGCCGGTCCAGGTTAATCGTTCGCCGCGCAGCCTCTCGGAAAGCGGCCCCTGGGCGCTGTTCCGAC
TGCTCGATAGCGCCGAGATTACCGGCGTGAGCAGTAGCGCGGTGGATGTGCGGTTCCGGGTCGACGACGG
GGAGATGCGTTATCGCCTCCATGCGGCCAGCAATACCAACCCGTTCACACAGCAACTACTGGCGGGGTAC
CGCATACCCCGCAGCTTGTATTAA
 Primer design