SecReT6
Protein ID: 385785940
SecReT6 ID601
T6SS typei3
Gene symbol-
Locus tagEJP617_04810
StrainErwinia sp. Ejp617
Repliconchromosome [GenBank: NC_017445] [Browse all T6SS(s) in this replicon]
Location [Strand]528597..532229 [-]
ProductType VI secretion system, IcmF protein
NoteTssM
UniProt IDE3DEV9
KEGG IDerj:EJP617_04810
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.80E-102, Aligned region: 208..488
IcmF-related [PF06761], Evalue: 8.10E-85, Aligned region: 330..391
IcmF-related [PF06761], Evalue: 8.10E-85, Aligned region: 536..839
DUF1215 [PF06744], Evalue: 5.90E-31, Aligned region: 952..1076
Protein Sequence: 1210 a.a.     [Download]
>gi|385785940|ref|YP_005817049.1| Type VI secretion system, IcmF protein [Erwinia sp. Ejp617]
MLNMLFAVLTHRLLWGFVGITALSFIIWVIGPVFSIVDSRPLEPEVNRQISIGLLYLVWALGNLVPRLYN
AWLNRKLMGSLKTTPGEQPGGDNPRLTSEDRVLAERFNEASELLKKAHFSHAAGRRSPFWAQRFSRQYLY
QLPWYVIIGAPGAGKTTALVNSGLQFPLADRFGKSALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQ
QQDAGEWHGFINLLRKYRGRQPINGVIVTVSVSDLLTQSAEAAQQQAVALRQRLTELHEQLGIRFPVYVL
VTKADLLKGFRAYFAKFDKVQREQIWGFTFPWERAKMSDFDLQAAFSQEYARLQQRLDAGLPDTLLQESD
GQARAESFLFPQEFAALRPLLAEYLDRVFARSDFETQFSPRGIYFASGTQEGLPFDRVMGELNRALQLPQ
QDAASGQSGSWDQTSKDAPIPGNKGQSFFLTDVLQKVIFPESGLAGSNRWWELRNRALLWSGYIALAAAL
VISALLWFTSYGNNKSYLQQVQARVPEVVRQSSALQGSEQGDLFALLPFLNSLLTLPESSEFDLNSPPIS
RRMGLYRGAEVSDATQALYQKSLKQLLLPQVAQLITGWLRNDNGSDADYSYEALKAYQMLYQPPHYDGKF
LHAWLMLNLQRTLPQNVTQAQLKQLEWHLSQLLENQIQASPYARDDALVKREQALINQMPLSQRVWGRLK
RLLEHDESLKAVSLASLGGPQSELVFSRKSGRSIADGIPGLFTPAGYWQSFDKHIAAVTAALHDDDRWVL
GAQSAGESQQQTDAAVRQLYIGDYIRQWDGLLQDIQLNNSADLAQRINSARLLSGNNSPLRKLVMNLSHY
LVLEKLPTDEKQAGKEKDAEADNSATRTLQALFRSRQNSTAATAEQTPEQAVANHFAPVIELAKPLEQGG
KTIAFDDFIRQIDDLYRYLTAVQDAANSGMPPPAGDAISHLQASAGRLPGSLQTLFSMLAVGASSDAQRR
ELENVRKRISSEVGGFCRQAIAGRYPLVRSARSEVTPDDLARMFAPGSGLMDSFFRDNLANKVDTTQSAW
RFTPGIDGKSIGGEDILRPFQQAQSIRDAFFANGATTPAFRVTVRTLRMDNEILNLTLDVDGQLLRYSHG
PQAVQLMNWPGSGGTNQVRMQLGLVDGTTSTLVTNGVWALNRFFDRAQLAPGSSSLSRQASFNVDGHRVT
LEFTPNSIRNPFQLSGFACP
 
Nucleotide Sequence: 3633 bp     [Download]
>gi|385785459|ref|NC_017445.1|:c532229-528597 Erwinia sp. Ejp617 chromosome, complete genome
ATGTTGAATATGCTGTTTGCCGTTTTAACCCACCGCCTGCTGTGGGGCTTTGTCGGTATCACCGCGCTGT
CGTTTATTATCTGGGTGATTGGTCCGGTATTTTCGATAGTCGACTCGCGCCCGCTGGAGCCTGAAGTCAA
CCGCCAGATCAGTATCGGCCTGCTCTATCTGGTGTGGGCGCTGGGTAACCTGGTGCCGCGCCTGTATAAC
GCCTGGCTGAACCGCAAGCTGATGGGCAGCCTGAAAACCACCCCTGGCGAACAGCCGGGCGGTGATAATC
CGCGTCTGACCAGTGAAGATCGGGTACTGGCGGAGCGTTTTAATGAAGCCTCCGAGCTGCTGAAAAAAGC
ACATTTCTCCCATGCTGCTGGCCGCCGTTCGCCGTTCTGGGCGCAGCGCTTCAGCCGTCAGTATCTTTAT
CAGCTGCCGTGGTATGTGATTATCGGCGCGCCGGGAGCCGGGAAAACCACCGCGCTGGTCAACTCCGGGC
TGCAGTTCCCGCTGGCCGACCGCTTTGGCAAATCCGCGCTGCGCGGCATTGGCGGCACGCGCAACTGCGA
CTGGTGGTTTACCAATGAAGCGGTGCTGCTCGATACCGCCGGGCGCTACACCACCCAGGAGAGTCAGCAG
CAGCAGGATGCCGGAGAATGGCACGGCTTCATTAACCTGCTGCGCAAATATCGTGGTCGCCAGCCGATCA
ACGGCGTGATTGTCACCGTCAGCGTCTCCGATCTGTTAACTCAGTCGGCCGAGGCCGCGCAGCAGCAAGC
GGTGGCGCTGCGCCAGCGCCTGACCGAACTGCATGAACAGCTGGGCATTCGTTTCCCGGTTTACGTGCTG
GTCACCAAAGCCGATCTGCTGAAAGGCTTCCGCGCCTACTTCGCCAAATTCGACAAGGTCCAGCGCGAAC
AGATCTGGGGTTTCACCTTCCCGTGGGAACGGGCGAAGATGAGCGATTTTGACCTGCAGGCGGCGTTCAG
CCAGGAGTACGCCCGGCTGCAACAGCGGCTGGATGCCGGATTGCCGGACACCCTGCTGCAGGAGAGCGAT
GGCCAGGCGCGTGCCGAAAGTTTTCTCTTTCCGCAAGAATTTGCCGCGCTGCGCCCGCTGCTGGCGGAAT
ACCTGGACAGGGTGTTTGCCCGCTCAGACTTTGAGACCCAGTTCTCACCGCGCGGCATCTATTTTGCCAG
CGGCACCCAGGAAGGGCTGCCGTTTGACCGGGTTATGGGCGAGCTTAACCGCGCCTTACAGCTGCCGCAA
CAGGATGCGGCCAGCGGCCAGAGCGGCAGCTGGGACCAGACCAGTAAAGACGCGCCGATCCCCGGCAACA
AGGGGCAGAGCTTCTTCCTGACGGACGTGCTGCAAAAAGTGATTTTCCCCGAGTCCGGGCTGGCGGGCAG
CAACCGCTGGTGGGAGCTGCGCAACCGGGCGCTGCTGTGGTCAGGCTATATCGCCCTCGCCGCCGCGCTG
GTGATTAGCGCGTTGCTGTGGTTTACCAGCTATGGCAATAACAAAAGCTATCTGCAGCAGGTGCAGGCGC
GGGTGCCGGAAGTGGTGCGGCAAAGCAGCGCGCTACAGGGCAGCGAGCAGGGCGATCTGTTTGCACTGCT
GCCGTTCCTCAACAGCCTGCTGACGCTGCCGGAAAGCAGCGAATTTGACCTGAACTCACCGCCGATAAGC
CGCCGTATGGGGCTGTATCGCGGAGCCGAGGTCAGCGATGCCACCCAGGCGCTGTACCAGAAATCGCTGA
AGCAGCTGCTGCTGCCGCAGGTGGCGCAGCTGATTACCGGCTGGCTGCGCAACGATAACGGCAGCGATGC
TGATTACAGCTATGAGGCGCTGAAAGCTTATCAGATGCTGTATCAGCCGCCGCATTATGACGGCAAGTTC
CTGCATGCCTGGCTAATGCTCAACCTGCAGCGCACTCTGCCGCAGAACGTCACTCAGGCGCAGCTGAAGC
AGCTGGAATGGCATCTTAGCCAGCTGCTGGAAAACCAGATCCAGGCTTCTCCCTATGCGCGGGATGACGC
GCTGGTAAAGCGCGAGCAGGCGCTGATTAACCAGATGCCGCTGTCACAGCGCGTCTGGGGGCGGCTCAAG
CGCCTGCTGGAGCACGATGAAAGCCTGAAAGCGGTGTCGCTGGCCTCTCTTGGCGGCCCGCAAAGCGAGC
TGGTGTTCTCGCGCAAGAGCGGTCGCTCGATTGCCGATGGCATTCCCGGCCTGTTTACCCCGGCCGGCTA
CTGGCAGAGCTTTGATAAGCATATTGCGGCGGTGACGGCGGCGCTGCATGATGACGACCGCTGGGTGCTG
GGCGCACAGTCAGCCGGGGAGAGCCAGCAGCAAACCGATGCGGCGGTGCGCCAGCTGTATATCGGCGACT
ATATCCGCCAGTGGGATGGCCTGTTACAGGACATTCAGCTGAACAACAGCGCCGATCTTGCCCAGCGCAT
CAATAGCGCCCGGCTGCTTTCCGGTAACAACTCGCCGCTGCGCAAACTGGTGATGAACCTCAGCCATTAT
CTGGTGCTGGAAAAATTGCCAACGGATGAGAAACAGGCGGGCAAAGAGAAGGACGCAGAAGCCGATAACA
GCGCCACCCGCACCCTGCAGGCGCTGTTCCGCTCGCGCCAGAATAGTACGGCGGCGACGGCAGAGCAGAC
GCCTGAACAGGCGGTGGCCAACCACTTTGCGCCGGTTATCGAACTGGCAAAGCCGCTGGAACAGGGCGGT
AAAACCATCGCCTTTGATGACTTTATCCGCCAGATTGATGACCTGTATCGCTATCTGACGGCGGTGCAGG
ATGCCGCCAACAGCGGCATGCCGCCGCCCGCCGGAGATGCCATCAGCCATCTGCAGGCCAGCGCCGGACG
GTTACCCGGTTCGTTGCAAACCCTGTTCTCCATGCTCGCGGTCGGTGCCAGCAGTGACGCGCAGCGCCGC
GAACTGGAAAACGTACGCAAGCGCATCAGCAGCGAAGTCGGTGGCTTCTGCCGCCAGGCGATTGCCGGGC
GCTACCCGCTGGTACGTTCGGCGCGCAGCGAAGTGACGCCGGATGACCTGGCGCGCATGTTTGCCCCCGG
CAGCGGCCTGATGGACAGCTTCTTCCGCGATAACCTTGCCAATAAAGTGGATACCACGCAGTCGGCCTGG
CGTTTTACGCCGGGCATTGACGGTAAGAGCATCGGCGGCGAAGACATTTTGCGCCCGTTCCAGCAGGCGC
AAAGCATCCGTGATGCCTTCTTTGCTAACGGTGCCACCACGCCAGCGTTTCGCGTGACGGTGCGCACGCT
GCGCATGGATAACGAGATCCTTAACCTGACGCTGGATGTTGACGGCCAGCTGCTGCGTTACAGCCACGGG
CCGCAGGCGGTACAGTTGATGAACTGGCCGGGCAGTGGCGGCACTAACCAGGTGCGTATGCAGCTGGGGC
TGGTGGATGGCACCACCTCTACGCTGGTGACTAACGGCGTCTGGGCGCTGAACCGCTTCTTTGACCGTGC
ACAGTTAGCGCCGGGCAGCAGCAGCCTGAGCCGTCAGGCCAGCTTTAACGTTGACGGCCATCGCGTGACG
CTGGAGTTCACTCCGAACAGCATCCGCAATCCGTTTCAGCTTTCCGGGTTCGCATGCCCGTAG
 Primer design