SecReT6
Protein ID: 386012585
SecReT6 ID605
T6SS typei1
Gene symbol-
Locus tagPPUBIRD1_3048
StrainPseudomonas putida BIRD-1
Repliconchromosome [GenBank: NC_017530] [Browse all T6SS(s) in this replicon]
Location [Strand]3415657..3416778 [-]
ProductATPase
NoteTssH
UniProt IDE4R4P3
KEGG IDppb:PPUBIRD1_3048
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-35, Aligned region: 87..268
ClpB_D2-small [PF10431], Evalue: 1.50E-17, Aligned region: 277..349
AAA_5 [PF07728], Evalue: 4.80E-10, Aligned region: 93..217
AAA [PF00004], Evalue: 6.10E-10, Aligned region: 93..222
AAA [PF00004], Evalue: 6.10E-10, Aligned region: 269..292
Sigma54_activat [PF00158], Evalue: 1.70E-08, Aligned region: 90..225
Sigma54_activat [PF00158], Evalue: 1.70E-08, Aligned region: 244..286
AAA_16 [PF13191], Evalue: 3.70E-06, Aligned region: 62..177
AAA_16 [PF13191], Evalue: 3.70E-06, Aligned region: 156..186
AAA_16 [PF13191], Evalue: 3.70E-06, Aligned region: 228..296
AAA_17 [PF13207], Evalue: 0.0004, Aligned region: 96..133
AAA_22 [PF13401], Evalue: 0.0012, Aligned region: 93..190
AAA_33 [PF13671], Evalue: 0.0024, Aligned region: 93..208
Protein Sequence: 373 a.a.     [Download]
>gi|386012585|ref|YP_005930862.1| ATPase [Pseudomonas putida BIRD-1]
MPFLNDLLEQTRRDASSSAALSAENCHTRAIVETHLRSEDTLQSRFRFDVAAVMQVVRNEVLGQDEALQA
IEDVLTVVRADILDPRRPLFTALFLGPTGVGKTEVVRALARALHGDADAFCRVDMNTLAQEHYAAALTGA
PPGYAGAKEGRTLFDQALLDGSQGRPGIVLFDELEKASKEVSQALLNVFDNGLLRLASGEKSFNFRNTLV
FMTSNLAADEIRQHRLGPLAPLRRLLGLQAGRRERLLGLVRRRLVKRFSAEFVNRIDSTVVFNAIEQEVS
ERIIELEVSRLNRRLAKHHCRLQLDAAVVGKLASEGHDLEFGARALKRFIRHELEVPLAEYLLGNRIPCQ
AEVTCMTVAGHLERGRIRFSLPT
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|386009639|ref|NC_017530.1|:c3416778-3415657 Pseudomonas putida BIRD-1 chromosome, complete genome
ATGCCGTTCTTGAATGACCTGCTGGAGCAGACGCGTCGCGATGCGTCCTCCAGTGCTGCACTGAGTGCCG
AAAACTGCCACACCCGGGCAATCGTCGAGACCCACCTGCGCAGTGAAGACACCCTGCAGTCGCGTTTCCG
CTTCGATGTCGCTGCCGTCATGCAGGTAGTACGCAACGAAGTGCTGGGCCAGGACGAAGCCTTGCAGGCC
ATCGAAGATGTGCTCACGGTGGTGCGTGCGGATATTCTCGACCCGCGCCGCCCGCTGTTCACGGCATTGT
TCCTCGGCCCGACCGGGGTCGGCAAGACCGAGGTCGTGCGTGCCCTGGCCCGCGCCCTGCACGGTGATGC
CGATGCCTTCTGCCGGGTCGACATGAACACGCTGGCCCAGGAACACTACGCCGCTGCTCTGACCGGCGCA
CCACCGGGCTATGCTGGCGCCAAGGAAGGCCGCACGCTGTTTGACCAGGCGCTGCTGGACGGGAGCCAAG
GGCGCCCAGGGATCGTGCTGTTCGATGAGCTGGAGAAGGCCAGCAAGGAGGTGTCCCAGGCGCTGCTCAA
TGTGTTCGACAATGGCCTGCTGCGCTTGGCCTCCGGTGAAAAGAGCTTCAATTTCCGTAACACACTGGTG
TTCATGACCAGCAACCTGGCGGCAGACGAAATACGCCAGCACCGGCTGGGCCCGCTGGCGCCGCTGCGGC
GTCTGCTTGGCCTGCAGGCAGGGCGCCGCGAGCGTTTGCTGGGGTTGGTGCGGCGGCGCCTGGTGAAGCG
TTTTTCTGCCGAGTTCGTCAACCGCATCGACAGCACTGTGGTGTTCAATGCCATCGAACAGGAGGTGAGC
GAGCGCATCATTGAACTGGAGGTGTCGCGCCTGAACCGGCGTCTTGCCAAGCATCACTGCCGCCTGCAGC
TGGATGCGGCGGTGGTTGGCAAGCTGGCCAGCGAAGGCCATGACCTGGAGTTTGGCGCGCGTGCACTCAA
GCGCTTTATCCGCCATGAGCTGGAAGTGCCACTGGCCGAGTACCTGCTTGGTAACCGCATCCCATGCCAG
GCAGAAGTGACGTGCATGACGGTGGCCGGCCACCTTGAGCGCGGGCGCATCCGTTTTTCGTTGCCGACAT
GA
 Primer design