SecReT6
Protein ID: 386012599
SecReT6 ID605
T6SS typei1
Gene symbol-
Locus tagPPUBIRD1_3063
StrainPseudomonas putida BIRD-1
Repliconchromosome [GenBank: NC_017530] [Browse all T6SS(s) in this replicon]
Location [Strand]3435210..3438830 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDE4R4Q7
KEGG IDppb:PPUBIRD1_3063
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.40E-84, Aligned region: 110..157
IcmF-related [PF06761], Evalue: 4.40E-84, Aligned region: 524..831
ImcF-related_N [PF14331], Evalue: 2.70E-69, Aligned region: 218..476
DUF1215 [PF06744], Evalue: 1.80E-29, Aligned region: 928..1049
Protein Sequence: 1206 a.a.     [Download]
>gi|386012599|ref|YP_005930876.1| ImcF domain-containing protein [Pseudomonas putida BIRD-1]
MKQIWTQLKRWGWPWVTRIGLALPLLLGFGALLMLVAIWWLGPQWTWREQQPLASVAHRSVASLVLVLVP
LLCWLWVLRTRFRRLQAERRQALAAEQDVALPFVQAQERALSQGLERYLDNAGGRRALYRLPWYLVLGDE
QSGKSSFIDRTDQRFTLTRIDQAQARGRQAEALAFPVGWWVSDDAVIIDPPGVFISQKAPAGSAANDPTN
ASAPPGIQARLWEHLLGWLQRKRSQRALNGVLLVVDLPALLHGKPEQRVALAHGLRTRLYEVSSQLGARL
PLYVVLTKFDLLDGFDQFYSQLPAAKRESLLGFTFKLDAVDAFDAWLDEYDEHYGRLLTQLHEQVIDRLD
VLGNTAPCGRLFSLHAQLIGLRPILQAFLRETLASDRFTTPPLVRGVYWSSVVQQGDMRNAFVREAAQPY
TTKLPLREGKAQGRALVYFIQQAFRRVIYQEAGLAGDNVRVARSKRHLLWVGSGVGILAFSIAIASWQRY
ADINGTKAASVLAKSQEYSSHEVDMRLDPTGRNLLAPLDQIRDAVAVFGDYRAAWPLVADFGLYQGRNIG
PLVDEAYLSLLSKRFLPALASGVIDAMNAAPPGSEQQMDALRVYRMIEDRNSRRPEWVEGWMARQWQRAF
PGQGQLQRDLMQHLKYALAYADTDLPQYRQRVSEVQQALRKLPLPQRVYAALKQQSYQQLHAGLDLRHQV
GPAFDVVYQPSSGARQGGEDVRLAAMLTAKGFREYFEPHSQRFAEMAMVDQWALGERSQLDYSDVDRDAL
TERLYNLYSADYIDSWRRALNAFTVADFRDLDHGVAILEQLTGPAAPLQRLLDTVRDNTSLASSTAVESP
GELSTLRVATGKPEQQQALAIQRAFAGLGAMLQATGEKPSYYDETLGAVAAVLDYAKAVQDSPDRGKAAL
QAVHQRFAMTGQDPIGTLQRIATGLPEPISHQVRKLADQTAQVLNVEALRELERRWDADVYSFFQQRLAG
RYPFVVKAPDASLDDFEAFFGPKGRLQQFNDRYLKVFLKDNLEALQSAQHGQSLIRGDVIEQLELAERIR
ETFFDQRGKLSVQFSIEPLGLSANQRTSLLDLDGQLIAYTHGPSHITGIVWPNTFGQQVRSNLTLLRQNG
NSSSLEYRGPWSMFRLLSRGALNGRTATSVDLSFRTGDGVMRYRLNAEKAFNPITQQPFKGFRLPRGLLQ
QPASVVQAVLPDGQRP
 
Nucleotide Sequence: 3621 bp     [Download]
>gi|386009639|ref|NC_017530.1|:c3438830-3435210 Pseudomonas putida BIRD-1 chromosome, complete genome
ATGAAACAAATATGGACGCAACTCAAACGTTGGGGCTGGCCGTGGGTAACGCGCATTGGCCTGGCGCTGC
CGCTGCTGCTCGGGTTTGGTGCCTTGCTGATGCTGGTCGCTATCTGGTGGCTTGGCCCGCAATGGACGTG
GCGTGAGCAGCAGCCGCTGGCAAGTGTGGCTCATCGCAGCGTGGCAAGCCTGGTGCTCGTGCTGGTGCCG
CTTCTGTGCTGGCTTTGGGTGCTGCGCACGCGCTTTCGCCGCCTGCAAGCGGAGCGCCGCCAGGCACTGG
CTGCCGAACAGGATGTCGCGCTACCGTTCGTGCAGGCGCAAGAGAGGGCGTTGAGCCAGGGGCTTGAGCG
GTACCTCGATAATGCCGGTGGGCGACGCGCGTTGTACCGGCTGCCCTGGTACCTGGTGTTGGGCGACGAA
CAGTCCGGTAAAAGCAGCTTCATCGATCGCACCGATCAGCGCTTCACCCTGACGCGTATCGACCAGGCCC
AGGCACGGGGCCGACAGGCTGAAGCACTGGCCTTCCCGGTAGGCTGGTGGGTCAGTGACGATGCTGTGAT
CATCGATCCGCCCGGTGTTTTCATCAGTCAAAAAGCACCGGCTGGCTCGGCGGCCAACGACCCCACCAAT
GCCTCCGCGCCGCCCGGTATCCAGGCCCGTTTGTGGGAGCACCTGTTGGGCTGGCTGCAGCGTAAGCGAA
GCCAGCGGGCGCTCAATGGTGTGTTGCTGGTGGTCGACCTGCCGGCGCTGCTGCATGGCAAGCCTGAGCA
GCGGGTCGCGCTGGCACATGGGTTGCGCACACGCCTGTACGAAGTGAGCAGTCAGTTGGGGGCGCGCCTG
CCGCTGTACGTGGTACTGACCAAATTCGATCTGCTGGACGGCTTCGACCAGTTCTACAGCCAGCTTCCGG
CCGCCAAGCGTGAAAGCCTGTTGGGGTTCACCTTCAAGCTGGATGCGGTTGACGCGTTCGACGCCTGGCT
GGATGAGTATGACGAGCACTACGGGCGGCTTCTCACCCAATTGCATGAGCAGGTCATCGATCGGCTGGAT
GTACTGGGCAACACAGCACCGTGCGGGCGCCTGTTCTCACTGCATGCACAGCTGATCGGGTTACGCCCCA
TACTGCAGGCATTCTTGCGCGAAACCTTGGCGAGTGACCGGTTCACCACGCCCCCCTTGGTACGTGGTGT
GTACTGGTCGTCAGTGGTACAGCAAGGCGACATGCGCAATGCCTTTGTGCGTGAAGCGGCTCAGCCCTAT
ACGACGAAGCTGCCCCTGCGTGAAGGTAAGGCACAGGGGAGGGCGTTGGTCTATTTCATCCAGCAAGCAT
TCAGGCGGGTTATTTATCAGGAAGCCGGGCTGGCGGGCGACAATGTTCGGGTTGCGCGCAGCAAGCGCCA
CTTGCTGTGGGTGGGCTCTGGTGTAGGCATCCTGGCGTTCAGTATCGCCATTGCCAGCTGGCAGCGTTAC
GCCGATATCAATGGCACCAAGGCTGCCAGTGTGCTCGCCAAAAGCCAGGAGTACAGCAGTCACGAAGTCG
ATATGCGTCTTGATCCGACCGGGCGCAACCTGCTGGCGCCACTGGACCAGATTCGCGATGCGGTGGCGGT
GTTTGGCGACTATCGTGCGGCCTGGCCGCTGGTTGCCGATTTTGGCTTGTATCAAGGGCGCAACATTGGT
CCCTTGGTTGATGAGGCGTACCTCAGCTTGTTGTCCAAACGTTTCTTGCCGGCCTTGGCCAGTGGTGTGA
TCGATGCCATGAACGCAGCACCACCTGGCAGCGAGCAACAAATGGACGCGCTCAGGGTTTACCGGATGAT
CGAGGACCGTAACAGCCGCCGGCCCGAATGGGTCGAGGGCTGGATGGCCCGTCAGTGGCAACGGGCCTTT
CCTGGCCAGGGGCAGTTGCAGCGTGACCTCATGCAGCACCTGAAATACGCCTTGGCCTATGCCGATACCG
ATTTGCCGCAGTACCGCCAGCGGGTCAGCGAAGTGCAGCAGGCGTTGCGCAAATTGCCATTGCCACAGCG
GGTCTATGCAGCGCTGAAACAACAATCGTACCAGCAGTTGCACGCCGGGCTGGACCTGCGTCATCAGGTA
GGGCCTGCGTTCGACGTGGTGTACCAGCCGTCTTCCGGGGCCAGACAAGGGGGTGAGGATGTAAGGCTGG
CCGCCATGCTCACCGCCAAAGGCTTCAGGGAATACTTCGAGCCGCACAGCCAGCGCTTCGCTGAAATGGC
GATGGTTGATCAATGGGCATTGGGGGAGCGCAGTCAACTCGACTATTCGGACGTCGACCGCGATGCGTTG
ACCGAGCGGCTGTATAACCTCTACAGCGCCGATTACATTGACAGCTGGCGGCGCGCCCTGAACGCGTTTA
CGGTGGCTGACTTCCGTGATCTGGACCATGGTGTCGCGATCCTGGAGCAGTTGACCGGCCCCGCAGCACC
GTTGCAGCGGCTGCTGGACACGGTCAGGGATAACACCTCGCTTGCGTCTTCAACAGCTGTTGAATCCCCA
GGTGAGCTGAGTACGCTGCGGGTAGCAACCGGAAAACCCGAGCAACAGCAAGCGTTGGCCATCCAGCGGG
CGTTTGCAGGCCTGGGCGCCATGCTGCAGGCGACAGGAGAAAAGCCGAGCTACTACGATGAAACCCTTGG
CGCTGTTGCGGCCGTGCTGGACTACGCCAAGGCCGTACAAGACAGCCCGGACCGCGGCAAGGCTGCGTTG
CAAGCCGTGCATCAGCGCTTTGCGATGACAGGGCAGGACCCGATCGGCACCCTGCAACGTATTGCTACAG
GTTTACCGGAGCCTATCAGCCACCAGGTCAGAAAGCTCGCCGACCAGACTGCCCAGGTGCTGAACGTTGA
AGCACTGCGCGAACTGGAGCGACGTTGGGATGCTGACGTGTACAGTTTTTTCCAGCAACGCCTGGCAGGC
CGCTACCCCTTTGTGGTGAAGGCACCCGATGCTTCGCTGGATGACTTCGAGGCGTTCTTCGGACCGAAAG
GGCGCCTGCAGCAGTTTAATGATCGGTATCTCAAGGTTTTCCTGAAGGACAATCTTGAGGCTTTGCAGTC
CGCTCAGCACGGGCAATCCCTGATTCGTGGCGACGTGATCGAGCAGCTCGAGCTGGCGGAGCGCATCCGC
GAAACATTCTTCGATCAGCGTGGCAAGCTGAGTGTGCAGTTCAGCATCGAGCCCTTGGGGCTCAGTGCGA
ACCAGCGTACCAGCCTGCTGGACCTGGATGGCCAGTTGATTGCCTACACCCATGGGCCAAGCCATATCAC
GGGTATTGTCTGGCCCAATACCTTTGGGCAGCAGGTCCGCAGCAATCTCACCTTGCTAAGGCAAAATGGC
AACAGCAGCAGCCTGGAGTACCGTGGCCCGTGGTCGATGTTCCGCTTGCTAAGCCGCGGCGCGCTCAATG
GCCGGACGGCGACCAGCGTGGACCTGAGCTTCAGGACCGGAGATGGCGTGATGCGCTATCGGCTTAACGC
TGAAAAAGCCTTCAATCCCATTACCCAGCAACCTTTCAAAGGCTTCCGCTTGCCCCGAGGCTTGTTGCAA
CAGCCAGCCAGTGTGGTGCAGGCGGTGCTACCGGATGGGCAGCGACCATGA
 Primer design