SecReT6
Protein ID: 386012600
SecReT6 ID605
T6SS typei1
Gene symbol-
Locus tagPPUBIRD1_3064
StrainPseudomonas putida BIRD-1
Repliconchromosome [GenBank: NC_017530] [Browse all T6SS(s) in this replicon]
Location [Strand]3438827..3440290 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDE4R567
KEGG IDppb:PPUBIRD1_3064
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.10E-17, Aligned region: 54..114
Protein Sequence: 487 a.a.     [Download]
>gi|386012600|ref|YP_005930877.1| ImpA domain-containing protein [Pseudomonas putida BIRD-1]
MSVVAQVSGEEVTRLLAPIDPAVPAGLFDVEDETYQAIDQEMVKLGGLQEASIDWVYIEDASRQYLGLQC
KHLRIVAHLSAAWLRSGCWERWGCTLALLAGMLECYWEAAHPKPGPKGFLGKRKLVALVIDRLAEALPRL
DRFTYTPTHAAAAQAALKRLQQQETVQLDTAALGELERLLGKYSELASGGGEAAVPKAPAATEKPAPLAD
VIATPVSRMSMGNERETRRAVLSMAELINQQDPYDATGYQLRRFGLWAHIQVAPQVRQGNRTELMAVPLD
ITRVYEEAIASQVVDPALLQRIEKSLTACPFWIRGSFLAATVATQLAMCEVAEAIRCATARFVQRMPSLQ
QLCFSDGLVFVDDQCLAWLKGTQGPSGQGATPQEFSGLREELVSQLETGGVEPLLLRLQGLQAGFRAPRE
RCHTTVIAADLLAARGVSWLAQDLCASVARTMQQTTASAWEPEVFQRLQQYAASPALAVQDKDQEPR
 
Nucleotide Sequence: 1464 bp     [Download]
>gi|386009639|ref|NC_017530.1|:c3440290-3438827 Pseudomonas putida BIRD-1 chromosome, complete genome
ATGTCGGTGGTAGCGCAGGTATCCGGGGAAGAGGTCACTCGGTTGCTCGCGCCGATTGATCCGGCAGTTC
CGGCTGGCCTGTTCGATGTCGAGGACGAAACCTACCAGGCCATTGATCAGGAGATGGTCAAGCTGGGTGG
GCTGCAGGAAGCCTCGATCGACTGGGTCTACATCGAAGACGCGTCCCGTCAGTACCTGGGCCTGCAGTGC
AAGCACTTGCGAATCGTTGCGCACCTGAGTGCCGCATGGTTGCGTAGCGGCTGCTGGGAGCGGTGGGGGT
GCACCTTGGCGTTGCTGGCCGGCATGCTCGAGTGCTATTGGGAGGCCGCTCATCCCAAGCCGGGACCGAA
AGGCTTCCTGGGCAAGCGCAAGCTGGTTGCCCTGGTGATCGATCGCTTGGCCGAGGCGCTCCCGCGTCTT
GATCGTTTTACCTACACCCCGACCCACGCAGCGGCAGCGCAGGCTGCCTTGAAACGCTTGCAACAACAGG
AAACGGTGCAGCTGGACACGGCAGCACTGGGCGAACTTGAGCGCCTGCTAGGCAAATACTCGGAACTTGC
CAGCGGTGGCGGCGAGGCTGCTGTGCCCAAAGCGCCGGCTGCAACCGAGAAGCCTGCACCGTTGGCCGAT
GTCATCGCCACACCCGTGTCACGCATGTCGATGGGCAATGAGCGTGAGACACGCCGGGCCGTGCTGTCCA
TGGCCGAGCTCATCAACCAGCAGGATCCTTACGACGCTACCGGCTACCAGTTACGGCGTTTCGGTCTGTG
GGCGCACATTCAGGTTGCTCCCCAAGTCAGGCAGGGCAACCGTACGGAATTGATGGCGGTGCCGCTGGAT
ATCACGCGGGTCTATGAAGAGGCCATAGCCAGTCAGGTGGTTGACCCCGCCTTGCTGCAGCGCATTGAAA
AGAGCCTGACGGCTTGCCCCTTCTGGATTCGTGGCAGCTTTCTGGCTGCGACCGTCGCCACACAGCTGGC
GATGTGCGAGGTGGCCGAGGCCATCCGTTGTGCCACCGCCCGGTTTGTACAGCGTATGCCGTCGCTGCAG
CAGTTGTGCTTCAGCGACGGGCTGGTATTTGTCGATGACCAGTGCCTGGCCTGGCTCAAGGGCACGCAAG
GGCCGTCAGGCCAAGGTGCAACCCCCCAGGAGTTCAGCGGTCTGCGCGAGGAGCTGGTCAGCCAGCTGGA
AACCGGTGGCGTAGAACCGCTGCTCCTTCGGCTGCAAGGGCTGCAAGCGGGCTTTCGTGCTCCCCGTGAG
CGTTGCCACACCACGGTGATTGCAGCCGATCTGCTGGCCGCGCGGGGTGTGTCCTGGCTGGCCCAGGACC
TATGCGCCAGCGTTGCCCGAACCATGCAGCAAACCACCGCCAGTGCGTGGGAGCCCGAGGTATTTCAGCG
GCTTCAGCAGTACGCCGCATCCCCAGCGCTGGCAGTTCAAGACAAGGATCAGGAGCCTCGATGA
 Primer design