SecReT6
Protein ID: 386012602
SecReT6 ID605
T6SS typei1
Gene symbol-
Locus tagPPUBIRD1_3066
StrainPseudomonas putida BIRD-1
Repliconchromosome [GenBank: NC_017530] [Browse all T6SS(s) in this replicon]
Location [Strand]3441255..3441758 [+]
Producthypothetical protein
NoteTssB
UniProt IDE4R569
KEGG IDppb:PPUBIRD1_3066
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 2.20E-54, Aligned region: 6..158
Protein Sequence: 167 a.a.     [Download]
>gi|386012602|ref|YP_005930879.1| hypothetical protein PPUBIRD1_3066 [Pseudomonas putida BIRD-1]
MSKNTGSVAPKERVNIKYVPATSDEQAEVELPHKMLVLGDFGLDDNRALEDRQVMRIDKHTFNSVLNDAN
VSLDVKVPSRLGTAPDTELAVHLQFRSINDFGPDRIARQVPELNKLLALREALVALKGPLGNVPAFRKQL
QHLLNNEQARKQLAQELDLVLEAPEQD
 
Nucleotide Sequence: 504 bp     [Download]
>gi|386009639|ref|NC_017530.1|:3441255-3441758 Pseudomonas putida BIRD-1 chromosome, complete genome
ATGTCTAAAAATACGGGATCCGTTGCGCCGAAAGAACGCGTCAATATCAAGTATGTCCCCGCTACCAGCG
ATGAGCAGGCTGAGGTGGAGCTGCCGCACAAGATGCTGGTGCTGGGCGACTTCGGCCTGGATGACAACCG
GGCGCTTGAGGACCGTCAGGTCATGCGCATCGATAAACATACATTCAACAGCGTGTTGAACGACGCCAAC
GTGAGCCTGGACGTAAAGGTACCGTCCAGGCTCGGCACCGCCCCGGATACCGAACTGGCCGTCCACCTGC
AGTTCAGGTCCATCAACGATTTCGGGCCGGACCGGATCGCGCGCCAGGTGCCCGAGCTGAACAAGCTGCT
GGCGCTGCGCGAAGCACTGGTCGCCCTGAAAGGCCCGCTGGGTAACGTCCCGGCCTTCCGCAAGCAATTG
CAGCACCTGCTTAACAACGAGCAGGCGCGTAAGCAGCTCGCCCAAGAACTGGACCTGGTGCTAGAGGCGC
CAGAACAAGATTGA
 Primer design