SecReT6
Protein ID: 386012603
SecReT6 ID605
T6SS typei1
Gene symbol-
Locus tagPPUBIRD1_3067
StrainPseudomonas putida BIRD-1
Repliconchromosome [GenBank: NC_017530] [Browse all T6SS(s) in this replicon]
Location [Strand]3441776..3443224 [+]
Producthypothetical protein
NoteTssC
UniProt IDE4R570
KEGG IDppb:PPUBIRD1_3067
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 5.90E-134, Aligned region: 70..391
Protein Sequence: 482 a.a.     [Download]
>gi|386012603|ref|YP_005930880.1| hypothetical protein PPUBIRD1_3067 [Pseudomonas putida BIRD-1]
MPKPSSTAITTDATADTLSNATLLDQIMAETKLVPAQEGYQIARQGVSAFITEILKSNDPDQLINKHRAD
QMIAEIDRMLGKQMDAILHQPEFQQLESSWRSLKLLVDRTDFRENIKLEVLHVTKEDLLDDFENAADITC
SGIYKHVYTAGYGQFGGEPVAAMVGNYNFGPSSPDIKLLSYMASVGAMSHAPFLAAPAPEFFNLNSFEEL
PNLKEIKDLFAGPRHAKWRAFRESEDARHVALTGPRFMLRSAYHPQEQPIESFNYNEDIAGQHDNYLWGN
SAFLLASCINDSFARYRWCPNIIGPQSGGAVEDLPVHLYESLGQLQAKIPTEVLISDRKEFELAEEGFIA
LTMRKDSDNAAFFSANSVQKPKHFPKTPEGLQAQTNYKLGTCPARAPAGCGPTPARTPPRKCGSATARTC
GPTPSPPVSPVRQPCANGTCASWTWPSWLAATRRRPPSPMCCQSVPCKPGSKTSSQPSGACR
 
Nucleotide Sequence: 1449 bp     [Download]
>gi|386009639|ref|NC_017530.1|:3441776-3443224 Pseudomonas putida BIRD-1 chromosome, complete genome
ATGCCCAAGCCAAGCAGCACCGCCATCACCACAGACGCAACGGCCGACACATTGAGCAATGCCACCTTGC
TCGACCAGATCATGGCAGAAACCAAGCTGGTGCCTGCTCAGGAGGGCTACCAGATTGCCAGGCAGGGCGT
ATCTGCCTTCATCACCGAAATCCTCAAGAGCAATGACCCGGATCAACTGATCAACAAGCACCGGGCCGAC
CAGATGATTGCCGAGATCGACCGAATGCTCGGCAAACAGATGGATGCCATTCTGCATCAGCCTGAGTTCC
AGCAGCTTGAATCATCATGGCGCAGCCTGAAACTTCTGGTCGACCGCACGGACTTCAGGGAGAACATCAA
GCTTGAAGTCTTGCATGTCACTAAAGAGGACCTGCTCGACGACTTCGAAAATGCTGCTGACATTACCTGC
AGCGGTATCTACAAGCATGTTTACACCGCGGGTTATGGCCAATTCGGGGGAGAGCCGGTTGCGGCCATGG
TAGGCAACTACAACTTCGGCCCCTCTTCCCCTGACATCAAGTTGCTAAGTTACATGGCCTCCGTTGGCGC
CATGTCCCATGCCCCTTTTCTTGCTGCACCGGCCCCCGAATTCTTCAATTTGAACAGCTTCGAGGAGCTG
CCTAACCTCAAGGAAATAAAAGACCTCTTCGCCGGCCCTCGGCATGCCAAGTGGCGCGCTTTTCGTGAAA
GCGAAGACGCCCGCCACGTCGCCCTGACCGGGCCGCGCTTCATGCTTCGCTCCGCTTACCACCCGCAGGA
ACAACCGATCGAGAGCTTCAACTACAACGAAGACATCGCCGGGCAGCACGACAACTACCTATGGGGCAAT
TCTGCTTTTCTGTTAGCCAGTTGCATCAACGACAGCTTCGCCCGCTACCGCTGGTGCCCGAACATCATCG
GCCCCCAATCGGGCGGTGCTGTCGAAGACTTGCCGGTCCATCTGTACGAATCCCTGGGCCAGTTGCAGGC
CAAGATTCCTACCGAGGTGCTGATATCCGACCGCAAGGAATTCGAACTGGCTGAAGAGGGCTTCATCGCC
CTGACCATGCGCAAAGACAGCGACAACGCCGCGTTTTTCTCCGCCAACTCGGTACAAAAGCCCAAGCACT
TCCCGAAAACCCCTGAGGGGCTGCAGGCCCAGACCAACTACAAGCTGGGTACCTGTCCGGCCAGAGCACC
GGCTGGGTGTGGGCCGACACCTGCCAGGACTCCGCCGAGGAAGTGTGGATCGGCTACAGCCCGCACCTGT
GGACCAACGCCATCACCGCCCGTATCACCGGTTCGGCAGCCCTGCGCAAACGGCACATGCGCCAGCTGGA
CATGGCCGAGCTGGTTAGCGGCAACCCGGCGCCGTCCACCCAGCCCCATGTGCTGCCAGTCAGTGCCCTG
CAAACCTGGGTCGAAGACTTCAAGCCAACCGAGCGGCGCATGCCGCTAA
 Primer design