SecReT6
Protein ID: 386016260
SecReT6 ID606
T6SS typei3
Gene symbol-
Locus tagPAJ_1670
StrainPantoea ananatis AJ13355
Repliconchromosome [GenBank: NC_017531] [Browse all T6SS(s) in this replicon]
Location [Strand]2019932..2023222 [-]
Producthypothetical protein
NoteTssM
UniProt IDF2EX42
KEGG IDpaj:PAJ_1670
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.30E-97, Aligned region: 96..374
ImcF-related_N [PF14331], Evalue: 2.30E-97, Aligned region: 713..737
IcmF-related [PF06761], Evalue: 8.60E-86, Aligned region: 423..729
DUF1215 [PF06744], Evalue: 6.50E-31, Aligned region: 749..776
DUF1215 [PF06744], Evalue: 6.50E-31, Aligned region: 838..963
Xpo1 [PF08389], Evalue: 0.0073, Aligned region: 466..491
Xpo1 [PF08389], Evalue: 0.0073, Aligned region: 521..553
Xpo1 [PF08389], Evalue: 0.0073, Aligned region: 667..710
Protein Sequence: 1096 a.a.     [Download]
>gi|386016260|ref|YP_005934546.1| hypothetical protein PAJ_1670 [Pantoea ananatis AJ13355]
MLKKAHFQRQSSKGAPFWAQRFSHQYLYQLPWYMIIGAPGAGKTTALVNSGLQFPLADKFGKAALRGIGG
TRNCDWWFTNEAVLLDTAGRYTTQESQQERDAGEWHQFLDLLRKYRGRQPVNGVIVTLSVADLLSQSPEA
MRNQAVALRQRLMELHDRLGIRFPVYVLVTKTDLLKGFRSYFASLDKAQREQIWGFTFPWAKASTAEFEL
SSQFQQEYSLLQQRLDAGLADVLLAESDAQARAESYLFPQEFAALRPQLAEALDILFARSDFETQFAPRG
IYFASGTQEGLPFDRVMGELTRALHLPGQQQSESGSWDKVDKDAPIPQNKGQSFFLKGVLENVIFQESGL
AGSNRWWELRNRVGLWSGYLALLVIVLIAGALWLVSYNKNKTYLQEMAAKSPQVEQLGDKLQKEVNGNLF
ALVPYLNTLLHLPESASFSLEHPPLTRRMGLYRGTEVSDATQALYERALKQLLMPQVAQNITRWLRNDTG
SDADYSYEALKAYQMLYQPKHYDGKFLQAWMMLNISRELPQDVTQAEVKQLAWHLQQLLETQIQSSPYAK
DDALVKREQALISQMPLSQRVYGRLKRLLERDGSMSPVTLSALGGPQSELVFSRKSGKSVNEGVSGLFTP
DGYWNHVDKQIAPVTDALYKDDIWVLGAETAHEDSKQTDLAVRQLYIQDYIRQWEQFLSDIQLNSSADLT
QRINTARLLSGNHSPLRQLVINLSKQLTLTRAQPEDKNAKDTAASSDNSATRTLQALFTSPRANGEQAVV
QQTPEQAVTAHFAPVIELAQPLQQGSKVLAVDDFLKQIDDLYRYLTAVQDAANSGMPPPASDAISRLQAS
AGRLPGSLQNMVSGMAVGASSDAQRRDMDNVRKRITMEVGSFCRQAIAGRYPLVRNARSEVTPDDLARMF
APGTGLMDSFFRDNLASKVDTTRAAWRFTPGIDGKTLPGGEALLRPFQQAQSIRDAFFANGATTPSFRVT
LRTVKMDNDILNMTLDVDGQILRYSHGPQAVQLVSWPGPGGTSQVRMQLGLTNGTTSTLTTSGPWALNRF
FDRARVTSVGGLTREASFSVDGHNVTLSFTPGSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3291 bp     [Download]
>gi|386014600|ref|NC_017531.1|:c2023222-2019932 Pantoea ananatis AJ13355, complete genome
ATGCTGAAAAAAGCACACTTCCAGCGGCAGAGCAGCAAAGGTGCGCCTTTCTGGGCGCAGCGCTTCAGTC
ATCAATATCTCTATCAACTGCCCTGGTACATGATCATCGGCGCGCCAGGTGCCGGTAAAACCACCGCTCT
GGTGAATTCTGGCTTGCAGTTCCCACTGGCGGACAAGTTCGGTAAGGCTGCGCTACGTGGGATCGGCGGG
ACGCGTAACTGTGACTGGTGGTTTACTAACGAAGCCGTGCTGCTGGATACGGCGGGGCGCTATACCACGC
AGGAGAGCCAGCAGGAGCGCGATGCCGGCGAATGGCATCAGTTTCTCGACCTTCTGCGTAAATACCGTGG
CCGTCAGCCGGTTAACGGCGTCATCGTCACCTTGAGCGTGGCAGACCTGTTATCACAGTCGCCCGAGGCC
ATGCGCAATCAGGCCGTGGCGCTGCGCCAGCGTCTGATGGAGCTGCACGATCGGCTTGGTATTCGCTTTC
CGGTGTATGTCCTGGTCACCAAAACCGACCTGTTGAAGGGGTTCCGCAGCTACTTTGCCAGCCTGGATAA
GGCACAGCGCGAGCAGATTTGGGGCTTTACCTTTCCGTGGGCCAAAGCATCAACGGCTGAATTTGAACTC
AGCAGCCAGTTTCAGCAGGAATATTCGCTGCTGCAACAGCGCCTGGATGCCGGACTGGCCGATGTGCTGC
TGGCGGAAAGTGATGCCCAGGCACGTGCCGAAAGCTACCTGTTTCCACAGGAGTTTGCGGCATTGCGCCC
TCAGTTGGCTGAGGCGCTGGATATTCTGTTTGCGCGTTCCGATTTCGAAACGCAGTTCGCCCCGCGCGGC
ATCTACTTTGCCAGCGGTACGCAGGAAGGCTTACCCTTTGACCGCGTAATGGGTGAACTGACGCGCGCCC
TGCATCTGCCAGGCCAGCAGCAGAGTGAGTCGGGCAGTTGGGACAAAGTGGATAAAGACGCGCCGATCCC
TCAAAACAAAGGCCAGAGTTTTTTCCTTAAGGGCGTGCTGGAAAATGTCATCTTCCAGGAGTCCGGTCTG
GCTGGCAGTAACCGCTGGTGGGAGCTACGTAACCGCGTGGGCCTGTGGTCGGGTTATCTGGCGTTACTGG
TTATCGTACTCATTGCCGGTGCACTGTGGCTGGTGAGCTATAACAAAAACAAAACCTACCTGCAGGAGAT
GGCGGCGAAAAGCCCCCAGGTTGAGCAGCTCGGTGACAAGTTACAAAAAGAGGTGAACGGCAACCTCTTT
GCACTGGTGCCTTACCTCAATACGCTGCTGCACCTGCCTGAAAGCGCATCCTTTTCTCTGGAGCATCCGC
CGCTCACGCGCCGGATGGGGCTGTATCGCGGAACGGAAGTCAGTGATGCGACCCAGGCCTTGTACGAAAG
GGCGCTGAAACAGCTGCTGATGCCGCAGGTTGCCCAGAATATCACCCGCTGGTTACGCAATGATACGGGA
AGTGACGCTGACTACAGCTATGAGGCGCTCAAGGCTTATCAGATGCTGTACCAGCCAAAACACTATGACG
GTAAGTTTCTTCAGGCGTGGATGATGTTAAACATCTCGCGTGAATTGCCGCAGGACGTGACTCAGGCTGA
GGTGAAACAGCTGGCGTGGCATCTGCAACAGCTACTGGAAACGCAGATTCAGTCCTCGCCCTATGCGAAG
GATGATGCGCTGGTAAAGCGCGAGCAGGCGCTGATTAGTCAGATGCCGCTGTCACAGCGCGTTTACGGAC
GCCTGAAACGCCTGCTGGAACGCGATGGCTCAATGTCACCGGTTACCTTGTCCGCGCTGGGTGGACCGCA
AAGTGAACTGGTTTTTTCCCGTAAAAGCGGTAAGTCTGTCAATGAAGGTGTTTCCGGGCTCTTTACGCCA
GACGGCTACTGGAACCATGTGGATAAACAGATCGCGCCGGTCACGGATGCGCTCTACAAAGACGATATCT
GGGTGCTGGGTGCAGAGACGGCCCATGAAGACAGCAAACAAACCGACCTTGCGGTGCGCCAGCTCTATAT
TCAGGATTACATCCGCCAGTGGGAGCAGTTTCTCAGCGATATTCAACTCAACAGCAGCGCCGATTTGACC
CAACGTATTAATACGGCGCGCCTGCTGTCAGGGAATCATTCGCCGCTGCGGCAGTTAGTGATTAACCTGA
GCAAACAGCTCACGCTCACCCGGGCGCAGCCTGAAGACAAGAATGCCAAAGATACGGCCGCGTCATCGGA
TAACAGCGCCACACGAACGCTGCAGGCACTGTTTACCTCGCCGCGCGCAAACGGCGAGCAGGCGGTGGTG
CAGCAAACGCCTGAGCAGGCGGTGACCGCGCACTTTGCACCTGTCATTGAGCTGGCACAGCCGTTACAGC
AGGGCAGTAAGGTCCTGGCCGTTGATGATTTTCTTAAGCAGATCGACGATCTCTATCGCTATCTCACTGC
CGTGCAGGATGCCGCGAATAGCGGTATGCCACCGCCGGCGAGTGATGCCATTAGCCGTTTGCAGGCCAGC
GCCGGACGTTTGCCCGGTTCACTGCAAAATATGGTGTCAGGCATGGCAGTGGGCGCCAGCAGCGATGCAC
AGCGTCGCGACATGGATAACGTTCGCAAGCGCATCACCATGGAAGTCGGCAGCTTCTGCCGTCAGGCGAT
AGCAGGCCGTTACCCGCTGGTCCGGAATGCACGCAGCGAAGTCACGCCTGATGACCTGGCGCGCATGTTT
GCGCCGGGAACCGGACTGATGGACAGCTTCTTCCGCGATAATCTGGCCAGCAAAGTGGATACCACGCGCG
CGGCATGGCGCTTCACGCCCGGCATTGATGGCAAAACCTTGCCAGGTGGCGAAGCCTTGCTGCGTCCTTT
CCAGCAGGCGCAGTCGATTCGCGACGCCTTCTTTGCCAATGGGGCCACTACGCCATCCTTCCGCGTCACG
TTACGGACGGTGAAGATGGATAACGATATCCTGAATATGACGCTGGATGTCGATGGACAGATTTTGCGCT
ACAGTCATGGACCACAGGCAGTGCAGTTAGTGAGTTGGCCCGGACCAGGTGGAACCAGTCAGGTGCGCAT
GCAACTGGGGCTAACGAACGGCACGACCTCAACCCTGACCACCAGCGGCCCATGGGCGCTTAATCGCTTC
TTTGATCGCGCACGGGTGACGTCGGTAGGTGGACTGACTCGCGAAGCCAGCTTTAGTGTGGACGGCCATA
ATGTGACGCTGTCATTCACGCCAGGCAGCATTCGTAATCCTTTCCAGCTACCCGCATTTAGCTGTCCCTG
A
 Primer design