SecReT6
Protein ID: 386018507
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0148
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]160275..162131 [+]
Producthypothetical protein
NoteTssM
UniProt IDF2EZ88
KEGG IDpaj:PAJ_p0148
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 1.80E-27, Aligned region: 435..616
PMT [PF02366], Evalue: 0.00036, Aligned region: 17..71
Protein Sequence: 618 a.a.     [Download]
>gi|386018507|ref|YP_005941113.1| hypothetical protein PAJ_p0148, partial [Pantoea ananatis AJ13355]
MKLPLAPKTTEGRYLAVALIFFLLLAVMTFMVWKHPDIAGIEDGSQQQIYWLIAGGCISGCALIVSVVLL
AAVRSAGKQEFNALVDNTNGDDEKKKRENDKAPVHPAVAMCNKIRGHLRSRIGLYWRRKTRLLLITGDEA
AIEQLVPGLQENQWLEGNRTVLIYGGSLTAEPDKEKYTALRKLRRGRPLDGIVRVLPQSLNLTPQVSDND
LRGLEKISELLRYSAPVWLWQLCDSSWSQAKRLEQAVGAAFPLRADHSDIVRQLERMLPALREQGMSQVL
ENNGHDFLLRLGRQLQDGGIARLAQQLVPWLAVSQQRVPLRGLMFSLPENKPASTAEETAGAAPADAEKY
IPASQRHALTLPVTWQGIVDDCTRVRGRRVGLAWENTLARTLMAVIGIWGAGTLLSFAANRQQIVSVAQQ
AHALVAHPAVSDDQLTALHRLRNEAGRLQHRIQEGAPWYQRFGLDHNAQLLGAVLPWYGVANNRLIRDPA
NQALTQKLSALANTAPNSDQRAQLAKPGYDQLKAWLMMARPDKADGAHYARTLKAVQPTRTGISTGLWQS
LSPDLWAFYITELPEQPQWTITPDAQLVSQCRQVLLQQIGRRNAESTLYENMLKSLRR
 
Nucleotide Sequence: 1857 bp     [Download]
>gi|386018361|ref|NC_017533.1|:160275-162131 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
GTGAAGCTACCTTTAGCACCGAAGACTACGGAAGGCCGCTATCTTGCTGTCGCATTGATTTTCTTTTTGC
TGTTAGCCGTTATGACGTTCATGGTCTGGAAGCATCCGGATATAGCCGGGATTGAAGACGGAAGTCAGCA
GCAAATCTACTGGCTTATCGCCGGAGGATGTATTTCAGGCTGCGCCCTTATCGTATCCGTAGTGCTGCTG
GCGGCAGTTCGTAGTGCCGGTAAGCAGGAGTTTAATGCGCTTGTCGACAATACCAACGGTGATGATGAGA
AAAAGAAACGGGAAAATGATAAAGCGCCTGTTCACCCTGCGGTGGCCATGTGTAACAAGATTCGGGGACA
TCTCCGCTCCCGTATTGGCCTTTACTGGCGTCGTAAAACCCGTCTGTTGCTCATCACTGGCGATGAGGCG
GCAATCGAACAGCTGGTACCTGGCCTGCAGGAAAACCAGTGGCTTGAAGGCAACCGCACTGTGCTGATTT
ACGGCGGCAGCCTGACTGCTGAGCCCGATAAGGAAAAATACACCGCGCTGCGTAAACTGCGTCGCGGACG
ACCGCTGGACGGGATTGTCCGCGTACTGCCGCAGTCGCTTAATCTGACCCCGCAGGTCAGCGACAACGAT
TTACGCGGGCTGGAAAAAATCAGTGAACTGCTGCGTTATTCCGCCCCGGTCTGGCTGTGGCAGCTGTGCG
ACAGCAGTTGGTCGCAGGCAAAACGTCTAGAGCAGGCGGTGGGGGCAGCCTTTCCGCTGCGCGCAGACCA
CAGCGACATTGTCCGCCAGCTTGAGCGGATGCTGCCGGCCCTGCGGGAGCAGGGGATGAGTCAGGTGCTC
GAGAATAACGGCCACGACTTCCTGCTGCGTCTGGGCCGGCAGCTGCAGGACGGCGGTATCGCCCGACTGG
CTCAGCAGCTGGTGCCCTGGCTCGCCGTCTCACAGCAGCGCGTTCCGCTGCGTGGCCTGATGTTCAGCCT
GCCGGAGAATAAACCCGCCTCTACCGCAGAAGAAACAGCCGGTGCTGCACCTGCCGACGCTGAGAAATAT
ATCCCGGCATCACAACGCCATGCGCTGACGCTGCCGGTAACCTGGCAGGGCATTGTGGATGACTGTACCC
GCGTGCGTGGCCGCCGGGTCGGCCTGGCGTGGGAGAACACGCTCGCCCGGACGCTGATGGCGGTTATCGG
TATCTGGGGCGCAGGAACCCTGCTCTCGTTTGCGGCCAACCGCCAGCAGATTGTCTCTGTGGCGCAGCAG
GCGCATGCCCTGGTGGCGCATCCTGCCGTATCAGATGACCAGCTGACGGCCCTGCACAGGCTGCGCAACG
AAGCCGGTCGCCTGCAGCACCGTATTCAGGAAGGTGCGCCCTGGTATCAGCGCTTTGGTCTGGACCATAA
TGCGCAGCTGCTGGGTGCGGTGCTCCCCTGGTACGGCGTGGCGAACAACCGCCTGATACGCGACCCGGCG
AATCAGGCGCTGACACAGAAACTCAGCGCACTGGCAAACACTGCCCCCAACAGCGACCAGCGTGCACAGC
TGGCGAAGCCGGGTTATGACCAGCTTAAAGCCTGGCTGATGATGGCCCGGCCGGATAAAGCCGACGGCGC
GCACTACGCACGGACCCTGAAAGCCGTGCAGCCGACGCGAACGGGTATTTCCACCGGCCTGTGGCAGAGC
CTGTCGCCTGATTTATGGGCCTTCTATATCACCGAACTGCCTGAACAGCCGCAGTGGACAATCACGCCGG
ATGCGCAGCTGGTCAGCCAGTGCCGCCAGGTGCTGCTGCAGCAGATTGGACGCCGCAACGCGGAAAGCAC
GCTGTATGAAAACATGCTCAAATCCCTGCGCCGGTAA
 Primer design