SecReT6
Protein ID: 386018508
SecReT6 ID608
T6SS typei2
Gene symbol-
Locus tagPAJ_p0149
StrainPantoea ananatis AJ13355
Repliconplasmid pEA320 [GenBank: NC_017533] [Browse all T6SS(s) in this replicon]
Location [Strand]162025..163761 [+]
Producthypothetical protein
NoteTssM
UniProt IDF2EZ89
KEGG IDpaj:PAJ_p0149
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 6.80E-37, Aligned region: 37..170
IcmF-related [PF06761], Evalue: 6.80E-37, Aligned region: 244..270
DUF1215 [PF06744], Evalue: 2.50E-32, Aligned region: 293..413
Protein Sequence: 578 a.a.     [Download]
>gi|386018508|ref|YP_005941114.1| hypothetical protein PAJ_p0149 [Pantoea ananatis AJ13355]
MRSWSASAARCCCSRLDAATRKARCMKTCSNPCAGNFAEVSLEDMTSGTDARRLFTTEEVVPGMFTRQAW
EGGIQQAIDKAANSRRDEIDWVLSDSGRDVSADLSPEALKARLTQRYFTDFAGSWLSFLNSLRLNPANNI
ADVTDQLTLMSDIRQSPLIALMNTLAWQGQTGQQSEGLSDSIIKSARELVGGKDKPAIDQSATGPRGPLD
ETFGPLLQLLGKNTGSNVMSADNSLSLQTYLTRITRVRLRLQQVAGASDPQAMMQTLAQTVFQGKSVDLT
DTRQYGSLIAASLGEEWSGFGSTVFVQPLTRAWESVLGPSAAGLNDKWSRSVVANWHTAFNGRFPFAASK
SDASLPVLAEFVRKDSGRIERFLATELSGVLHREGSQWVPDRVNSQGLSFDPAFLRAINQLSRLSDILFT
DGSQGLSFELQARPVPQVVETQLTIDGQKLHYFNQMVSWQRFRWPGETYRPGTMLTWTTVSAGARLFGDY
GGTWGLIRWLEQGRREQLDHSRWMMSFTAPDGRTLQWVLRSQHENGPLALLDLRGFTLPDQIFSVDSAIA
DRALIAHTGNSDADGIEP
 
Nucleotide Sequence: 1737 bp     [Download]
>gi|386018361|ref|NC_017533.1|:162025-163761 Pantoea ananatis AJ13355 plasmid pEA320, complete sequence
ATGCGCAGCTGGTCAGCCAGTGCCGCCAGGTGCTGCTGCAGCAGATTGGACGCCGCAACGCGGAAAGCAC
GCTGTATGAAAACATGCTCAAATCCCTGCGCCGGTAACTTTGCCGAGGTCTCTCTTGAAGACATGACCAG
CGGAACGGATGCGCGGCGACTGTTCACCACCGAAGAGGTGGTGCCGGGCATGTTCACCCGCCAGGCCTGG
GAAGGCGGCATTCAGCAGGCGATTGATAAGGCTGCTAACTCACGCCGGGATGAAATCGACTGGGTGCTGA
GCGATTCCGGCAGGGACGTCTCCGCGGACCTGTCGCCGGAGGCCCTGAAGGCGCGCCTGACGCAGCGTTA
CTTCACCGACTTTGCCGGCAGCTGGCTGAGCTTCCTGAACAGCCTGCGTCTTAACCCGGCGAACAATATT
GCAGACGTGACCGACCAGCTGACGCTGATGAGTGATATACGCCAGTCGCCACTGATAGCCCTGATGAATA
CCCTCGCCTGGCAGGGGCAGACCGGCCAGCAAAGCGAAGGTCTTTCGGACTCCATCATCAAATCGGCCAG
AGAGCTAGTTGGTGGAAAAGACAAACCCGCAATTGACCAGTCAGCGACAGGTCCCCGGGGGCCGCTGGAT
GAAACTTTCGGTCCGCTGCTTCAGCTTTTGGGTAAAAACACGGGCAGTAACGTCATGTCGGCTGACAACT
CGCTGAGCCTGCAGACGTATCTGACCCGTATCACCCGCGTGCGGCTGCGGCTGCAGCAGGTGGCCGGCGC
CTCCGATCCACAGGCGATGATGCAGACCCTGGCGCAGACCGTATTTCAGGGCAAAAGCGTGGACCTGACC
GACACCCGGCAGTACGGCAGTCTGATTGCGGCAAGTCTGGGGGAAGAGTGGAGCGGGTTTGGCAGCACGG
TGTTTGTGCAGCCGCTGACCCGGGCCTGGGAGAGCGTGCTTGGGCCGTCGGCAGCGGGCCTGAATGACAA
ATGGAGCCGGTCCGTGGTGGCGAACTGGCACACCGCCTTTAACGGGCGTTTCCCGTTTGCGGCGAGCAAA
AGTGATGCCTCTCTGCCGGTGCTGGCTGAGTTTGTGCGCAAGGACAGCGGACGCATTGAGCGCTTCCTGG
CAACGGAGCTCAGCGGTGTGCTGCACAGAGAGGGCAGCCAGTGGGTGCCGGACAGGGTCAACAGCCAGGG
GCTGAGCTTTGACCCGGCCTTCCTGCGGGCCATTAACCAGCTGAGCCGGCTGTCAGACATTCTGTTCACC
GACGGCAGTCAGGGGCTCAGCTTTGAGCTGCAGGCGCGCCCGGTACCGCAGGTGGTGGAAACGCAGCTGA
CCATTGACGGACAGAAGCTGCACTACTTCAACCAGATGGTCAGCTGGCAGCGTTTCCGCTGGCCGGGAGA
GACGTACAGGCCGGGGACCATGCTGACCTGGACCACGGTCAGCGCCGGTGCGCGCCTGTTCGGTGACTAC
GGCGGCACCTGGGGGCTGATCCGCTGGCTGGAGCAGGGCAGGCGGGAGCAGCTTGACCACAGCCGGTGGA
TGATGAGTTTTACCGCGCCGGATGGCCGGACCCTGCAGTGGGTGCTGCGCTCTCAGCACGAAAACGGTCC
GCTGGCGCTGCTGGACCTGCGCGGTTTCACGCTGCCGGATCAGATATTCAGTGTTGACAGCGCGATTGCC
GATCGGGCGCTGATAGCTCACACAGGAAACAGTGACGCAGACGGAATCGAACCATGA
 Primer design