SecReT6
Protein ID: 386018744
SecReT6 ID607
T6SS typeN/A
Gene symbol-
Locus tagPSTAA_0104
StrainPseudomonas stutzeri DSM 4166
Repliconchromosome [GenBank: NC_017532] [Browse all T6SS(s) in this replicon]
Location [Strand]122122..123093 [-]
Productprotein kinase
NoteStk1
UniProt IDF2MV91
KEGG IDpsr:PSTAA_0104
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 1.30E-33, Aligned region: 41..264
Pkinase_Tyr [PF07714], Evalue: 9.40E-23, Aligned region: 43..295
APH [PF01636], Evalue: 0.0031, Aligned region: 128..190
APH [PF01636], Evalue: 0.0031, Aligned region: 219..267
Protein Sequence: 323 a.a.     [Download]
>gi|386018744|ref|YP_005936768.1| protein kinase [Pseudomonas stutzeri DSM 4166]
MNAQPACDLTYFALASTAATPVSEAPKTPVGELPEVLGGRYRIERLLGVGGMGAVYRARDLLREQFGDPE
PYVALKTLSEDFAEYPDASALLYSEYALTTRLSHRHVVRLYNFDIDPASQRAFITLELLKGPTLDQLLCE
RPQGMAWNELQGIALPLLEALTYSHSLGVLHGDLKPSNVMLADDGLRLFDYGLGQPLEGLLPGLPRLCRT
RFAAWTPRYAALELLDGGELTAAADVYALACVLYELASGSHPYRRLSARQAKAMELDSSLQRPPQLPAHC
WPALRLALAFDEAQRSIDAAGLLQAFSRPAPNRWRRWFGHSHG
 
Nucleotide Sequence: 972 bp     [Download]
>gi|386018640|ref|NC_017532.1|:c123093-122122 Pseudomonas stutzeri DSM 4166 chromosome, complete genome
ATGAACGCCCAGCCCGCCTGCGATCTCACTTATTTTGCACTGGCCTCCACCGCGGCCACGCCGGTGTCGG
AGGCACCGAAAACGCCTGTCGGCGAGCTGCCGGAAGTCCTCGGCGGCCGCTACCGGATCGAGCGCCTGCT
CGGCGTCGGCGGCATGGGTGCGGTCTATCGCGCCCGTGACCTGCTGCGCGAACAGTTCGGCGATCCGGAG
CCCTACGTGGCGCTGAAGACGCTCAGCGAGGATTTTGCCGAGTACCCCGACGCCAGCGCCCTGCTCTACA
GCGAATACGCGCTGACCACGCGCCTTAGCCACCGGCATGTGGTGCGCCTGTACAACTTCGACATCGACCC
AGCCAGCCAGCGTGCCTTCATCACCCTGGAGCTGCTCAAGGGGCCAACCCTCGACCAGTTACTGTGCGAG
CGCCCGCAGGGCATGGCCTGGAACGAACTGCAGGGCATCGCGTTACCGCTGCTGGAGGCGCTGACCTATT
CACACAGCCTGGGCGTGCTGCATGGCGACCTGAAACCGAGCAACGTGATGCTCGCCGATGACGGCCTGCG
CCTGTTCGACTATGGGCTCGGACAACCGCTGGAAGGGCTGCTGCCCGGTTTGCCGCGCCTGTGCCGCACG
CGCTTCGCCGCCTGGACGCCGCGTTATGCCGCACTGGAGCTGCTCGACGGTGGCGAGCTGACCGCCGCGG
CGGATGTTTACGCCCTGGCCTGCGTGCTCTATGAACTGGCCAGTGGCAGCCACCCTTATCGCCGGCTCAG
CGCCCGTCAGGCCAAAGCCATGGAGCTGGACAGCTCCCTGCAGCGCCCGCCGCAGCTGCCCGCGCATTGC
TGGCCGGCGCTGCGTCTGGCGCTGGCATTCGACGAAGCGCAGCGCAGCATCGATGCAGCGGGCCTGTTGC
AAGCCTTCAGCCGCCCCGCACCGAACCGTTGGCGGCGCTGGTTCGGCCACTCCCATGGATGA
 Primer design