SecReT6
Protein ID: 386018745
SecReT6 ID607
T6SS typeN/A
Gene symbol-
Locus tagPSTAA_0105
StrainPseudomonas stutzeri DSM 4166
Repliconchromosome [GenBank: NC_017532] [Browse all T6SS(s) in this replicon]
Location [Strand]123090..123821 [-]
Productprotein phosphatase 2C domain-containing protein
NoteStp1
UniProt IDF2MV92
KEGG IDpsr:PSTAA_0105
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 3.00E-15, Aligned region: 20..206
PP2C [PF00481], Evalue: 2.40E-13, Aligned region: 30..205
SpoIIE [PF07228], Evalue: 2.40E-10, Aligned region: 37..242
Protein Sequence: 243 a.a.     [Download]
>gi|386018745|ref|YP_005936769.1| protein phosphatase 2C domain-containing protein [Pseudomonas stutzeri DSM 4166]
MNATACSWRSAARTDTGKVRARNEDAFLDLPQAGLWAVADGMGGHQNGALASRLIIEQLAELSRGGDLAE
RLRALRRCLHELNRRLSQELTVTAERPDPVIGSTVVALLMESDHAACIWAGDSRCYLWRSGRLYQLSRDH
SLLQQLIDEQQLSPELAAKHPAAHALTRAIGASEKLELDILEFAVFPGDTLLLCSDGLYQSMSADALGAA
LSLPSTQLALERLFRQALKGPARDNLSAVVIRR
 
Nucleotide Sequence: 732 bp     [Download]
>gi|386018640|ref|NC_017532.1|:c123821-123090 Pseudomonas stutzeri DSM 4166 chromosome, complete genome
ATGAACGCAACCGCGTGCAGCTGGCGCAGCGCCGCGCGCACCGACACCGGCAAGGTGCGTGCGCGCAACG
AAGATGCCTTTCTCGACCTGCCACAGGCCGGGCTCTGGGCCGTGGCCGACGGCATGGGCGGACACCAGAA
CGGCGCCCTGGCCAGTCGCCTGATCATCGAGCAGCTGGCCGAGCTTTCCAGGGGCGGCGATCTGGCCGAG
CGGCTGCGGGCGTTGCGGCGCTGTCTGCATGAGCTCAATCGCCGGCTCAGCCAGGAACTCACGGTCACCG
CCGAACGCCCCGATCCGGTGATCGGCAGCACCGTGGTCGCCCTGCTTATGGAAAGTGATCACGCAGCGTG
CATCTGGGCTGGCGACAGCCGCTGCTACCTGTGGCGTAGCGGCCGTCTCTATCAGCTGTCACGCGACCAC
TCGTTGCTGCAGCAACTGATTGACGAGCAGCAGCTCAGCCCCGAGCTTGCCGCCAAACACCCGGCCGCCC
ATGCATTGACCCGCGCCATAGGCGCGAGCGAGAAGCTGGAGCTGGATATCCTCGAATTCGCCGTATTCCC
GGGCGACACGCTGCTGCTGTGCAGCGATGGGCTCTACCAGAGCATGTCCGCCGACGCGCTCGGCGCCGCG
CTCAGCCTGCCGTCCACGCAGCTGGCGCTGGAACGGCTGTTTCGCCAGGCACTCAAGGGCCCGGCGCGAG
ACAATCTCAGCGCCGTGGTGATACGCCGATGA
 Primer design