SecReT6
Protein ID: 386018746
SecReT6 ID607
T6SS typeN/A
Gene symbol-
Locus tagPSTAA_0106
StrainPseudomonas stutzeri DSM 4166
Repliconchromosome [GenBank: NC_017532] [Browse all T6SS(s) in this replicon]
Location [Strand]123821..127360 [-]
ProductImcF domain-containing protein
NoteTssM
UniProt IDF2MV93
KEGG IDpsr:PSTAA_0106
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 4.60E-80, Aligned region: 502..793
ImcF-related_N [PF14331], Evalue: 2.30E-71, Aligned region: 197..453
DUF1215 [PF06744], Evalue: 2.70E-37, Aligned region: 76..96
DUF1215 [PF06744], Evalue: 2.70E-37, Aligned region: 914..1038
AAA_33 [PF13671], Evalue: 0.00019, Aligned region: 135..267
AAA_33 [PF13671], Evalue: 0.00019, Aligned region: 471..490
DUF4131 [PF13567], Evalue: 0.003, Aligned region: 15..113
DUF4131 [PF13567], Evalue: 0.003, Aligned region: 449..477
Protein Sequence: 1179 a.a.     [Download]
>gi|386018746|ref|YP_005936770.1| ImcF domain-containing protein [Pseudomonas stutzeri DSM 4166]
MKTFFGKLGAVLRRTWVWSLLLVLLLAVVVWFVGPLLAVDDYRFWESSTARLLSISVLFLGWGLAMVFAS
WRASARKKRDAEDQDVQEQLRRDGLIGEEQQELRHRFRQALRTLKTSSLYRGRSEKWRSELPWYLLIGPQ
GSGKTSLLDFSGLDFPLNRSEQQRLTKDVSGTRYADWYFADHAVLIDTAGRYLTQPDAAVDGSAWETLLG
LLRRRRARPLNGVLVNLPVDQLQGGSELELENLARQTRQRLHEIHQRLNVDVPVYLVLSKSDRILGFDEF
FEQLSREESDQVLGASFRKEQNGSDAQVVRQEFEELLRRLNSQVILRMHQERDTQRRGRILDFPHQLGQI
GERLSLFIELAFAGNRYQRASQLRGFYLTSAPQLRETLDPLTAGIGRQLGLASSALPTFRSGRARFINQL
LSRVIFPEAELAGLDQREVRRIDWGQRALYAGAFGCLLLFGGAWALNFSGNHERLEQLRDIAQELGSERK
TIAAGDEALRTLKALDASYAATQVFPPREEISWLRRGGLYQGEAVDPTLHEAYRRDLERLLLPRVARQLE
AQIRANLNDREQLLGSLRAYLMLNLAERRDAAFLKDWLAADWSLRHPGNAVAQQGLNTHFARLLEESFAA
YQLNDNLVAKARAQLRSESLAAVVYRMLRDQARNLPDYRLNTQLGPQASLFVGGDYTIPGFYTQRGYHKL
FVAQGADLVSEILRDNWVLGEGDSLSTKDLGRLLVEMEQLYFRDYAAHWSEAIAQLNILPAGSAAQGAAQ
LAGLTAANSPLLQLLLEVRENTRFAGLVEATAGAGELAEAAQGAGGKLGKAAKLATAAAEQAQTALLKNM
PDTARRTLERRFAPLHQLLDENGAPGPELSASLQALDALQLQLASLAHASAPEQAAFEMAKARMGGQRDA
INQLRSSAARLPQPLGKWLGLLAEDSWSLVLTDAYHYLNQRYRNELYASYRGSLRERYPFSAHSASDVAL
ADFREFFKAQGLADSFFERYLKPFVSGSAGEYQLRRVDGRGLPLSEQFLAQMSRAQTIRRSFFAENPNEP
LILFKLEPYSLDSSLGRADFRFGNQQMEYRHGPIVQTAFRWPAEADDGRTSLVVEELGGRRVGIEKNTGP
WSLFRLIDLMQVDYHSGRDVLMLKADLGGLRANYLLHAQRSPNPFDLALLRGFKLPATL
 
Nucleotide Sequence: 3540 bp     [Download]
>gi|386018640|ref|NC_017532.1|:c127360-123821 Pseudomonas stutzeri DSM 4166 chromosome, complete genome
ATGAAGACGTTCTTTGGCAAGCTCGGCGCCGTGCTGCGCCGGACCTGGGTCTGGAGCCTGCTGCTGGTCC
TGCTGCTGGCGGTCGTGGTGTGGTTCGTCGGGCCATTGCTGGCGGTCGACGACTACCGGTTCTGGGAATC
CTCGACCGCCCGCCTGCTGAGCATCAGCGTACTGTTTCTCGGCTGGGGGCTGGCCATGGTCTTCGCCAGC
TGGCGCGCCAGTGCGCGCAAAAAGCGCGACGCCGAGGACCAGGACGTTCAGGAGCAGCTGCGGCGCGACG
GCCTGATCGGCGAGGAGCAGCAGGAGCTGCGCCATCGCTTCAGGCAGGCGCTGCGCACCCTGAAGACCTC
CAGCCTCTACCGCGGGCGCAGCGAGAAATGGCGCAGCGAGCTGCCCTGGTACCTGTTGATCGGTCCGCAG
GGTAGCGGCAAGACTAGCCTGCTGGATTTCTCCGGCCTGGACTTTCCGCTCAATCGCAGCGAACAGCAGC
GCCTGACCAAAGACGTCTCCGGCACCCGCTATGCCGACTGGTACTTCGCCGATCATGCCGTGCTGATCGA
CACCGCCGGCCGCTACCTGACCCAGCCCGATGCAGCGGTCGACGGCAGCGCCTGGGAAACCCTGCTCGGT
CTGCTGCGCAGGCGCCGCGCCCGCCCGCTCAACGGCGTACTGGTCAACCTGCCGGTGGACCAGCTGCAGG
GCGGCAGTGAACTGGAGCTGGAGAACCTGGCCCGCCAGACCCGCCAGCGCCTGCACGAGATCCATCAGCG
TCTGAACGTGGACGTGCCGGTCTACTTGGTGCTGAGCAAGTCCGATCGAATTCTCGGTTTCGACGAATTC
TTCGAGCAGCTGTCTCGGGAGGAAAGCGACCAGGTGCTGGGTGCGAGTTTCCGCAAGGAGCAGAACGGCA
GCGATGCGCAGGTGGTGCGCCAGGAATTCGAGGAGCTGCTGCGCCGGCTGAACAGCCAGGTGATCCTGCG
CATGCACCAGGAACGCGATACACAGCGCCGCGGCCGAATCCTCGACTTCCCACATCAGTTGGGGCAGATC
GGCGAGCGCCTGAGCCTGTTTATCGAACTCGCGTTTGCCGGCAACCGATACCAGCGTGCCAGCCAGCTGC
GTGGTTTCTACCTGACCAGCGCGCCGCAGCTACGCGAAACGCTCGATCCGCTCACCGCCGGCATCGGCCG
CCAGCTCGGCCTGGCCAGCAGCGCGCTGCCGACGTTCCGCAGCGGTCGCGCGCGCTTCATCAACCAGCTG
CTCAGCCGGGTGATCTTCCCTGAAGCCGAACTGGCGGGCCTCGACCAACGCGAAGTACGCCGCATCGACT
GGGGCCAGCGTGCCCTCTATGCCGGAGCCTTCGGCTGCCTGCTGCTGTTCGGCGGCGCTTGGGCACTTAA
CTTCTCTGGCAACCATGAACGCCTTGAACAGCTGCGCGACATCGCCCAGGAACTCGGCAGCGAGCGCAAG
ACCATCGCGGCGGGAGACGAGGCTCTGCGCACCCTCAAGGCCCTCGATGCGAGCTATGCCGCGACACAGG
TCTTCCCGCCTCGGGAGGAGATTTCCTGGCTGCGCCGTGGCGGCCTCTATCAGGGCGAAGCGGTCGACCC
GACGCTGCACGAGGCCTACCGCCGCGATCTCGAAAGGTTGCTGCTGCCGCGCGTCGCCCGGCAGCTGGAG
GCGCAGATCCGCGCCAACCTGAATGACCGCGAGCAGCTGCTCGGCAGTCTGCGCGCCTATCTCATGCTGA
ACCTCGCCGAACGCCGTGATGCGGCGTTTCTCAAGGACTGGCTGGCCGCCGACTGGTCGCTGCGCCATCC
CGGCAATGCCGTGGCGCAGCAGGGCCTCAACACCCACTTCGCGCGCCTGCTGGAAGAATCCTTTGCTGCA
TACCAGCTGAACGACAATCTGGTAGCCAAGGCCCGCGCTCAGCTGCGCAGCGAATCGCTGGCGGCCGTGG
TGTACCGCATGTTGCGCGATCAGGCGCGCAACCTTCCCGACTACCGGCTGAACACGCAGCTCGGCCCGCA
GGCGTCGCTGTTCGTCGGCGGTGACTACACCATTCCAGGCTTCTACACCCAGCGCGGCTATCACAAGCTG
TTCGTCGCACAGGGCGCCGATCTGGTCAGCGAGATACTGCGCGACAACTGGGTACTGGGCGAAGGCGACA
GCCTCAGCACCAAGGACCTGGGCCGCCTGCTGGTGGAAATGGAACAGCTTTACTTCCGTGACTACGCCGC
GCACTGGAGCGAGGCGATTGCCCAGCTGAACATTCTCCCCGCCGGTAGTGCGGCGCAGGGTGCCGCGCAG
CTCGCCGGGCTCACCGCCGCGAACTCGCCGCTGCTGCAACTGTTGCTGGAGGTGCGCGAGAACACTCGGT
TCGCCGGTCTGGTCGAAGCGACTGCCGGGGCCGGCGAGCTGGCCGAAGCGGCGCAAGGCGCCGGCGGCAA
GCTCGGCAAGGCAGCCAAGCTGGCAACCGCCGCCGCCGAGCAAGCCCAGACCGCACTGCTGAAGAACATG
CCGGACACCGCGCGCAGAACCCTGGAGCGACGCTTCGCGCCGCTGCACCAGCTGCTCGACGAGAACGGCG
CGCCCGGCCCCGAGTTGAGCGCCAGTCTGCAAGCCCTCGACGCGCTGCAGCTGCAGCTCGCTTCCCTGGC
CCACGCCAGCGCACCGGAACAGGCCGCCTTCGAAATGGCCAAGGCACGTATGGGCGGCCAGCGCGATGCC
ATCAACCAACTGCGCAGCAGCGCTGCACGGCTGCCGCAGCCGCTGGGCAAGTGGCTGGGGCTGCTGGCCG
AAGACAGCTGGTCGCTGGTACTCACCGATGCCTACCATTACCTCAATCAGCGCTATCGCAACGAGCTTTA
CGCCAGTTACCGCGGTTCGTTGCGCGAGCGTTATCCGTTCAGCGCCCACAGCGCCAGCGATGTCGCCCTC
GCCGACTTCCGCGAGTTCTTCAAGGCCCAGGGCCTGGCGGACAGTTTTTTTGAGCGCTACCTCAAGCCCT
TCGTCAGCGGCAGCGCCGGCGAGTACCAGTTGCGCCGGGTTGACGGTCGCGGCTTGCCGCTGTCCGAGCA
GTTCCTGGCACAGATGAGTCGGGCCCAGACCATTCGCCGCAGCTTCTTTGCCGAGAACCCCAACGAGCCG
CTGATCCTGTTCAAGCTCGAGCCCTATTCGCTGGATTCGAGCCTCGGTCGCGCCGACTTCCGCTTCGGCA
ACCAGCAGATGGAATACCGCCACGGGCCGATCGTGCAGACCGCGTTCCGCTGGCCGGCCGAAGCCGACGA
CGGACGCACCAGCCTGGTGGTGGAAGAACTCGGCGGCCGTCGCGTGGGTATCGAGAAGAACACCGGGCCC
TGGTCGCTGTTCCGCCTGATCGACCTGATGCAGGTCGACTACCACAGCGGCCGCGACGTGTTGATGCTCA
AGGCCGATCTCGGCGGCCTGCGCGCCAACTACCTGCTGCATGCGCAGCGCTCGCCGAATCCGTTCGATCT
CGCGCTGTTGCGCGGCTTCAAGCTGCCGGCGACGCTGTGA
 Primer design