SecReT6
Protein ID: 386034527
SecReT6 ID609
T6SS typei2
Gene symbol-
Locus tagKPN2242_09825
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2067858..2071286 [+]
ProductImcF domain-containing protein
NoteTssM
UniProt IDG0GMS6
KEGG IDkpo:KPN2242_09825
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 8.40E-70, Aligned region: 416..734
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 251..293
DUF1215 [PF06744], Evalue: 1.10E-33, Aligned region: 857..977
Protein Sequence: 1142 a.a.     [Download]
>gi|386034527|ref|YP_005954440.1| ImcF domain-containing protein [Klebsiella pneumoniae KCTC 2242]
MDNVNKPAAISVAATVIVCIAAVTLLVLLGGLAWWLWAMDRATQWETLRPLIATGFIIWGMALSLLVLGF
MAFRLLIKDKVKPSAAPVRQPTRPAGREALYAPLKKHLHARYRLRWRRKVRLLLVTGDEAAIEQLVPGLR
QQHWLEGNRTVLIYGGSLASEPDREKYIALRKLRRGRPLDGIVRVMPSSLTLTPQISESDLRWLEKISEL
LRYAAPVWLWKLCDSEWPQADRAVQAVGVSFPLRATEEDAARQLAQMLPTLREQGMHQIAADTRHDFLLR
LGQQLIDGGIAQWRWQLAPWLTASRQRLALRGLMFSLPEPRTVDPYQEADTSPAGQPHLLTLPATWLGIV
DDCRRLRGHHVGMAWERGLACGLLAILGLWAAGLLLSFALNYSQIASVAGKARDLVAPPSVSDYQLTALH
ALRNEAGRLVHDGQKGAPWYRRFGLDHHQQLLNAVLPWYGVANHRLIRDPANAALQQALSALVNSAPNSD
QRARLAKPGYDQLKAWLMMARPDKADGAFFAQTMKTVQPTRMGISTGLWQSLAPDLWAFYLSLLPERPEW
KIIPDAQRVSQSRQVLLQQLGRRNAESTLYENMLKSVRRNFADVSLEDMTSGTDARRLFTTDEVVPGMFT
RQAWEGGIQQAIDKAASSRREEIDWVLSDSRKTMSTDLSPEALKARLTRRYFTDFAGSWLNFLNSLRLNP
ATTIADVTDQLTLISDVRQSPLIALMNTLAWQGQAGQQREGLSDSLIKSAKDLVGGKDKPVIDQSAAGPQ
GPLDDTFGPLLQLMGKNTGSNVMSADSTLSLQTYLTRITRVRLRLQQVANASDPQEMMQTLVQTVFQGKS
VDLTDTQQYGSLISASLGEEWSGFGNTLFVQPLTQAWETVLLPSAASLNDKWRRSVVANWHTAFDGRFPF
AASKSDASLPMLAEFVRKDSGRIERFLTTELNGVLHKEGSQWVPDKVNSHGLVFNPAFLRAINQLSQLSD
ILFTDGSQGISFELQARPAPEVVETQLTIDGQKLRYFNQMADWQTFRWPGETYKPGTLLTWTTVNAGTRL
FGDYSGTWGFIRWLEQGKRQPLDRSQWMMSFSAPDGRTLQWVLRSQLGSGPLALLALRGLTLPDQIFTVD
AAESAQVLTTGVGNSDMDEMEL
 
Nucleotide Sequence: 3429 bp     [Download]
>gi|386032579|ref|NC_017540.1|:2067858-2071286 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
ATGGACAACGTCAATAAACCTGCAGCTATCTCTGTGGCGGCTACGGTTATCGTCTGTATTGCTGCGGTCA
CGCTTCTGGTGCTCCTGGGCGGGCTGGCATGGTGGCTGTGGGCGATGGATCGTGCCACGCAGTGGGAAAC
GCTGCGCCCGCTTATCGCTACGGGCTTTATTATCTGGGGGATGGCACTCAGCCTGCTGGTACTGGGGTTT
ATGGCCTTTCGACTGCTGATAAAAGATAAGGTTAAGCCTTCAGCAGCGCCTGTGCGGCAACCCACCAGGC
CCGCCGGGCGCGAAGCCCTTTATGCCCCGCTGAAAAAGCACCTTCACGCACGTTACCGCCTGCGCTGGCG
GCGCAAAGTCCGCCTGCTTTTAGTCACCGGCGACGAGGCGGCAATCGAACAACTGGTGCCTGGCCTGCGT
CAGCAGCACTGGCTTGAAGGCAACCGCACCGTGCTGATTTACGGCGGCAGCCTTGCATCGGAGCCTGACC
GAGAAAAATACATCGCGCTGCGCAAGCTGCGCCGCGGTCGTCCTCTGGACGGGATTGTGCGGGTGATGCC
GTCGTCTCTGACCCTGACGCCGCAGATAAGCGAGAGCGACCTGCGTTGGCTGGAAAAAATCAGCGAACTG
CTGCGCTATGCCGCCCCGGTCTGGTTATGGAAACTGTGCGACAGTGAGTGGCCGCAGGCTGACCGCGCGG
TGCAGGCGGTAGGGGTTAGCTTCCCGTTGCGCGCCACTGAGGAAGATGCCGCCCGTCAGCTTGCGCAGAT
GTTGCCCACGCTACGGGAGCAGGGGATGCACCAGATCGCAGCAGATACCCGCCACGACTTTCTGCTGCGT
CTGGGGCAGCAGCTTATCGACGGGGGGATCGCGCAATGGCGCTGGCAGCTGGCGCCGTGGCTGACCGCCT
CGCGGCAGCGGCTTGCGCTGCGAGGCCTGATGTTTAGCCTGCCAGAGCCTCGTACCGTAGATCCGTATCA
GGAGGCGGATACCTCGCCTGCGGGCCAGCCTCATCTCCTGACGCTGCCCGCCACCTGGCTGGGGATCGTC
GATGACTGCCGCCGTTTACGCGGGCATCACGTGGGAATGGCGTGGGAGCGGGGCCTGGCGTGCGGTCTGC
TGGCCATCCTCGGCCTGTGGGCGGCGGGACTGCTGCTCTCCTTTGCCCTCAATTACAGTCAGATTGCTTC
GGTAGCGGGAAAAGCCCGCGACCTGGTGGCCCCCCCCTCCGTTTCTGACTATCAACTGACGGCCCTCCAT
GCCCTACGCAATGAGGCCGGCCGTCTCGTGCACGATGGGCAGAAGGGAGCGCCCTGGTATCGGCGCTTTG
GTCTGGACCATCATCAGCAACTATTAAACGCCGTCCTACCCTGGTACGGTGTGGCAAATCATCGCCTGAT
ACGTGACCCGGCCAATGCCGCGTTGCAGCAGGCGCTCAGCGCGCTGGTCAACTCCGCCCCCAATAGCGAC
CAACGAGCCAGGCTGGCGAAACCGGGCTATGACCAGCTGAAAGCCTGGCTGATGATGGCTCGTCCGGATA
AAGCCGATGGCGCATTTTTTGCGCAGACCATGAAAACGGTCCAGCCGACGCGAATGGGGATCTCGACCGG
TCTGTGGCAAAGTCTGGCGCCGGATTTGTGGGCCTTTTATCTCTCCCTGCTGCCCGAGCGGCCAGAGTGG
AAGATCATCCCGGATGCGCAACGGGTGAGTCAGAGCCGTCAGGTTCTGTTGCAGCAGCTAGGTCGCCGCA
ATGCCGAAAGCACCTTATATGAGAACATGCTCAAATCCGTGCGTCGTAATTTTGCCGATGTGTCGCTGGA
AGACATGACCAGTGGCACCGACGCGCGCCGCCTGTTTACCACCGATGAAGTGGTCCCGGGGATGTTTACC
CGCCAGGCATGGGAAGGTGGCATTCAGCAGGCCATTGATAAGGCAGCCAGCTCGCGCCGGGAGGAAATCG
ACTGGGTGCTGAGCGATTCGCGCAAAACGATGTCGACAGACCTGTCGCCGGAGGCGCTGAAAGCGCGTCT
GACCCGACGCTACTTCACCGATTTCGCCGGCAGCTGGCTGAATTTTCTCAACAGTCTGCGACTTAATCCG
GCGACCACCATTGCCGATGTTACCGACCAGCTCACGCTGATAAGCGATGTCCGCCAGTCGCCGCTGATTG
CCCTGATGAATACCCTTGCCTGGCAGGGGCAGGCGGGGCAACAAAGGGAGGGGCTGTCGGACAGCCTTAT
TAAATCGGCCAAAGATCTGGTGGGCGGGAAAGACAAGCCGGTCATCGACCAGTCGGCAGCCGGCCCGCAG
GGGCCTCTGGATGACACGTTCGGCCCACTGCTCCAGCTGATGGGGAAAAACACGGGCAGCAACGTCATGT
CGGCCGATAGCACCCTGAGCCTGCAAACCTATCTGACCCGTATCACCCGCGTGCGCCTGCGCCTGCAGCA
GGTTGCGAATGCTTCCGATCCGCAGGAGATGATGCAGACCCTGGTGCAGACCGTCTTCCAGGGGAAAAGC
GTCGACCTGACCGACACGCAACAGTACGGTAGCCTGATTTCGGCAAGCCTTGGCGAAGAGTGGAGTGGCT
TCGGTAATACTCTGTTTGTGCAGCCGCTGACTCAGGCCTGGGAAACCGTGCTTCTGCCGTCGGCGGCCAG
TCTGAATGATAAATGGCGCCGCTCGGTGGTCGCCAACTGGCACACCGCCTTTGACGGACGCTTTCCGTTT
GCCGCCAGCAAAAGCGACGCCTCCCTGCCGATGCTGGCTGAGTTTGTGCGCAAGGACAGCGGGCGGATCG
AACGTTTTCTCACGACGGAGCTGAACGGTGTCCTGCATAAAGAAGGCAGTCAGTGGGTGCCGGATAAGGT
CAACAGTCACGGCCTGGTCTTTAATCCGGCCTTTCTGCGCGCGATCAACCAGCTAAGCCAGCTGTCCGAC
ATTCTTTTCACCGACGGCAGCCAGGGGATCAGCTTTGAGTTACAGGCCAGGCCTGCCCCGGAGGTTGTCG
AGACACAGCTGACGATAGACGGCCAAAAGCTGCGCTATTTCAATCAAATGGCCGACTGGCAGACTTTCCG
CTGGCCGGGGGAGACGTATAAACCCGGCACTCTGCTTACCTGGACCACCGTCAATGCGGGCACGCGTCTG
TTTGGTGACTACAGCGGTACCTGGGGTTTTATTCGCTGGCTGGAGCAGGGTAAACGCCAGCCGCTGGATC
GCAGCCAGTGGATGATGAGCTTCTCCGCCCCGGATGGCCGCACTCTGCAGTGGGTATTGCGCTCCCAGCT
TGGGAGCGGCCCGCTGGCGCTTCTGGCGCTGCGCGGATTGACCCTGCCGGATCAGATTTTTACTGTCGAT
GCGGCTGAGAGCGCACAGGTCCTGACGACGGGGGTAGGGAATAGTGACATGGATGAGATGGAATTATGA
 Primer design