SecReT6
Protein ID: 386035395
SecReT6 ID610
T6SS typeN/A
Gene symbol-
Locus tagKPN2242_14265
StrainKlebsiella pneumoniae KCTC 2242
Repliconchromosome [GenBank: NC_017540] [Browse all T6SS(s) in this replicon]
Location [Strand]2964428..2967394 [-]
ProductImcF-related family protein
NoteTssM
UniProt IDG0GIF7
KEGG IDkpo:KPN2242_14265
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.30E-77, Aligned region: 268..586
DUF1215 [PF06744], Evalue: 2.50E-34, Aligned region: 484..533
DUF1215 [PF06744], Evalue: 2.50E-34, Aligned region: 707..825
Protein Sequence: 988 a.a.     [Download]
>gi|386035395|ref|YP_005955308.1| ImcF-related family protein [Klebsiella pneumoniae KCTC 2242]
MLLWGGDPATPADADWLAALRKLRRRAVDGMVWVTSALDGMPATENSATSGLTPDAMDSVSHALKLRYEA
LGWKLPLYVWSLHPRAGEQAGRVTQPVGCLLPANCSPQTLAGQLTGLIPQLTAQGIQQVCGQPQHNFLLA
LADQLTRKPETVTEPLSVLLNPYRPQPLAGVVFSAPSAEAGRSISHHWGRDNRWDILPDRMTELPAGLRP
RKQGVNWMRGMSVAAAALMLLWAASMTVSFIANRHLVAIAQEQVRLASAEKQPLAVRLHALSALQKTLSQ
LEYRSQHGAPWYLRAGLSQNDDLLAALFPHYGERAQPLLRDAAAHHLEEQLTAFVQLPPDSPLREKMTKT
AYGQLKQYLMLTRPEKMDAAWFATTLMQDWPQRSGIADAVWQGSGPSLLAFYAASLASHPQWRLPVDDGL
VSQVRTRLIRQLGQRNSESTLYQKMLAQVANQYADMRLADMTADTDASRLFSTDEVVPGMFTRQAWEQAV
QPAIEKVVAERRDEMDWVLSDTKQTAAQSTSPEALRARLAERYFADFSGAWLDFLNSLRWQRAATLSDAI
DQLTLMADVRQSPLVALMNTLSVQGRTGQTGEAIADSLVKSARQLFNRDNSPVIDQRSGARGPLDATFGP
VLALLDNRDGGTPTSRLSLQTFLTRVTQVRLRLQQVTNATDPQAMTRLLAQTVFQGKAVDLTETRDYGSL
VAAGLGQEWSGFGQTLFVRPMEQAWQQVLTPAAESLNAQWRSAVVEDWNSAFGGRYPFKNTSSEVSLPLL
AKYLNSETGRIARFLQTRLNGVLHKEGSRWMADSINAQGLTFNPAFLQAMNTLSHLSDVAFANGEAGLHF
ALRPGTADGVMQTELVIDSQKLVYMNQMPVWRRFSWPADTEAPGASLSWVSTRAGTRQYGDFPGAWGWIR
LLDKAVVSAYPGTSSSWSLSWKAPDGLLLNYTLRTEAGEGPLALLALRNFTLPETIFSVRASAERVPLTD
DIPGEEGY
 
Nucleotide Sequence: 2967 bp     [Download]
>gi|386032579|ref|NC_017540.1|:c2967394-2964428 Klebsiella pneumoniae KCTC 2242 chromosome, complete genome
GTGCTGCTGTGGGGTGGCGATCCTGCGACTCCGGCCGATGCAGACTGGCTGGCTGCGTTGCGTAAACTGC
GCCGCCGTGCGGTGGACGGAATGGTCTGGGTGACCTCAGCGCTGGACGGTATGCCGGCAACGGAAAACAG
CGCAACCTCAGGTCTCACGCCAGATGCAATGGATAGCGTGTCTCATGCTTTAAAGCTTCGCTATGAGGCT
CTGGGCTGGAAGCTGCCGCTGTACGTCTGGTCCCTGCATCCGCGCGCCGGAGAACAGGCCGGGCGCGTCA
CCCAGCCAGTGGGGTGCCTTTTGCCTGCGAATTGTTCACCGCAGACGCTCGCCGGACAGCTTACCGGGCT
GATACCGCAGCTGACCGCGCAAGGCATACAGCAGGTCTGCGGTCAGCCACAGCACAATTTTTTACTCGCG
CTGGCCGATCAGTTGACCCGTAAACCGGAAACGGTGACGGAGCCGTTATCGGTATTGCTTAATCCTTACC
GCCCGCAGCCGCTGGCCGGAGTGGTGTTCAGCGCGCCGTCGGCGGAGGCCGGCCGCAGTATCAGCCATCA
CTGGGGCCGGGATAACCGCTGGGATATTCTGCCGGACAGGATGACGGAATTACCCGCAGGTCTACGTCCG
CGCAAACAGGGAGTCAACTGGATGCGTGGGATGAGCGTGGCCGCCGCCGCCCTGATGTTACTCTGGGCCG
CCTCAATGACAGTCTCTTTTATCGCCAACCGCCACCTGGTGGCGATCGCACAGGAGCAGGTGCGGCTGGC
CTCAGCGGAGAAACAGCCGCTGGCCGTACGCTTGCATGCGCTCTCCGCGTTACAGAAAACGCTTTCTCAA
CTGGAATACCGCTCGCAGCACGGCGCGCCGTGGTACCTCCGCGCTGGCCTCAGTCAGAACGATGACCTGC
TGGCGGCGCTGTTCCCGCACTACGGAGAGAGGGCGCAGCCGCTGCTGCGCGATGCGGCGGCGCATCATCT
GGAAGAGCAGCTCACCGCCTTCGTGCAGCTGCCGCCGGACAGCCCACTGCGTGAGAAGATGACGAAGACC
GCTTACGGACAACTGAAACAATATCTGATGTTGACCCGCCCGGAAAAAATGGACGCCGCGTGGTTCGCCA
CTACGCTAATGCAGGACTGGCCGCAGCGCTCAGGCATCGCCGACGCCGTCTGGCAGGGCAGCGGCCCTTC
GCTGCTGGCATTTTATGCCGCCAGCCTGGCATCGCATCCGCAGTGGCGTCTGCCTGTCGATGACGGTCTG
GTCAGCCAGGTGCGCACACGGTTAATTCGCCAACTGGGCCAGCGCAACAGTGAGTCCACGCTTTACCAGA
AGATGCTCGCGCAGGTGGCGAATCAGTATGCCGATATGCGCCTGGCGGATATGACTGCCGACACCGATGC
TTCGCGTCTGTTCAGCACTGATGAGGTGGTGCCGGGAATGTTTACCCGTCAGGCCTGGGAGCAGGCCGTG
CAGCCGGCCATTGAGAAAGTGGTCGCGGAACGCCGCGATGAAATGGACTGGGTGCTGAGCGATACGAAGC
AGACTGCCGCGCAGTCGACGTCGCCGGAAGCTCTGCGAGCCAGGCTGGCGGAGCGTTATTTCGCTGATTT
CAGCGGCGCCTGGCTGGATTTCCTCAACAGTCTGCGCTGGCAGCGCGCGGCGACCCTCTCCGATGCTATC
GACCAGCTGACCCTGATGGCCGATGTGCGCCAGTCGCCGCTGGTGGCGCTGATGAACACCCTGAGCGTGC
AGGGGCGAACCGGCCAGACCGGGGAAGCCATCGCCGATTCGCTGGTCAAATCGGCCAGGCAGCTGTTCAA
CCGTGATAACTCGCCCGTCATCGATCAACGGTCCGGCGCGCGCGGTCCTCTGGATGCCACCTTCGGGCCC
GTACTGGCGCTGCTGGACAATCGCGACGGCGGGACACCCACCAGCCGTCTTAGCCTGCAGACCTTCCTGA
CCCGCGTCACCCAGGTGCGTCTGCGCCTGCAGCAGGTCACCAACGCCACCGATCCGCAGGCGATGACCCG
GTTGCTTGCGCAGACGGTATTCCAGGGCAAGGCCGTGGATTTAACCGAAACGCGCGACTACGGCAGCCTG
GTGGCGGCGGGGCTGGGCCAGGAGTGGAGTGGATTTGGGCAGACGCTGTTTGTTCGCCCGATGGAACAGG
CCTGGCAGCAGGTGCTGACCCCGGCGGCGGAAAGCCTCAACGCCCAGTGGCGCAGCGCAGTGGTGGAGGA
CTGGAATAGCGCTTTTGGCGGTCGCTACCCCTTTAAAAATACCAGCAGTGAAGTCTCTCTGCCGCTGCTG
GCAAAATACCTCAACAGCGAGACCGGGCGCATCGCCCGCTTTCTGCAGACCCGGCTGAACGGCGTGCTGC
ATAAAGAGGGAAGCCGCTGGATGGCGGACAGTATCAATGCTCAGGGGCTGACGTTTAACCCGGCCTTTCT
GCAGGCGATGAATACCCTGAGCCATCTCTCCGACGTCGCGTTCGCCAACGGCGAAGCGGGATTGCATTTT
GCGCTTCGCCCCGGCACGGCGGACGGCGTGATGCAGACGGAGCTGGTCATCGACAGTCAGAAACTTGTCT
ATATGAACCAGATGCCGGTCTGGCGGCGGTTCAGCTGGCCCGCTGACACCGAAGCGCCGGGCGCCAGTCT
GAGCTGGGTCAGTACCCGGGCGGGCACCCGCCAGTATGGCGATTTCCCGGGCGCCTGGGGGTGGATCCGT
CTGCTGGATAAGGCGGTGGTCAGCGCTTATCCCGGAACGAGCAGCAGCTGGAGCCTGAGCTGGAAAGCGC
CGGATGGTCTGTTGCTGAACTACACGCTGCGTACCGAGGCGGGGGAAGGACCGCTGGCGCTGCTGGCGCT
GCGAAACTTTACGCTACCGGAGACGATATTCAGCGTGCGCGCGTCTGCTGAACGTGTTCCGCTGACCGAC
GATATACCCGGCGAAGAGGGATACTGA
 Primer design