SecReT6
Protein ID: 386056148
SecReT6 ID611
T6SS typei3
Gene symbolicmF1
Locus tagPAM18_0079
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]89946..93476 [-]
ProductIcmF1
NoteTssM
UniProt IDG2KZW6
KEGG IDpaf:PAM18_0079
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 3.50E-98, Aligned region: 86..127
ImcF-related_N [PF14331], Evalue: 3.50E-98, Aligned region: 192..455
IcmF-related [PF06761], Evalue: 2.60E-92, Aligned region: 504..799
DUF1215 [PF06744], Evalue: 2.10E-40, Aligned region: 71..105
DUF1215 [PF06744], Evalue: 2.10E-40, Aligned region: 694..726
DUF1215 [PF06744], Evalue: 2.10E-40, Aligned region: 914..1035
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 130..287
AAA_10 [PF12846], Evalue: 0.0014, Aligned region: 598..683
AAA_16 [PF13191], Evalue: 0.0053, Aligned region: 127..255
AAA_16 [PF13191], Evalue: 0.0053, Aligned region: 594..645
AAA_16 [PF13191], Evalue: 0.0053, Aligned region: 777..849
Protein Sequence: 1176 a.a.     [Download]
>gi|386056148|ref|YP_005972670.1| IcmF1 [Pseudomonas aeruginosa M18]
MKGFLNFFARWVVPVLGLLALSLIIWFLGPLLRLGNYEPLASATSRWVLIVLLFLVWIGFRVLRIVQARR
NAAKVMQSLAEVSAPDAASVATAEELATLKQRMDEALALLKRAKLGGSERRNLYELPWYVIIGPPGSGKT
TALMNSGLDFPLAAQMGAGAIRGVGGTRNCDWWFTDEAVLLDTAGRYTTQDSHAQVDKAAWLGFLDLLKT
QRKRRPIDGAFIAISLSDLLLGSDAERAAHAQAIRARIQELYQQLGVRFPIYVMLTKFDLVPGFMEFFDS
LNREERAQVWGMTFALDDGKSAEGPLAVFDSEFALLEQRLTARLVERLQQERDPARRDLVYGFPQQFAAL
RECLGEFLNGVFKPNPYEERPLLRGLYFTSGTQEGSPIDRLIGSMAQSMNLDRQHLARQTGTGRSYFIER
LFREVAFGERGLVGTNPKVERRRKWLTIGALSATALVVLAVTAVWIASYRANQSYIAAVDQRVDPLARGI
ESLSPAQRDVLAVLPQLNAVQNLAGDAPSWAEGYGLYQGDMLGEESASVYRKLLIAVFAPRLVTRIEEQL
RSGGSSDFLYEGLKAYLMLGSPDHYDADFIKAWISLDWERNLPRDLSPEQRQALHAHLDALLERRPPSAR
LDQDLVEDLRRQLQQLPVAQRVYDRVKRQRLPKDVPDFRISDAAGRDAPLVFARKSGKPLTDPLSGFFTY
RGYREVFLTASLSQAGTIAEEQWVLGRDLNDAGDAANLALDVRRLYFQDYLRQWDDLLADLTVVPITNVT
QAADVLRILSGPTSPFRKLLEAVARETDLQKGDRLVAAQVKKAADGTVDKLKQRLGSLVGQEEEGAREQP
RQVDSDPISAHFAELNSLVSKGEGGNEPAPIDSLLEDMNALYVQVSAMAGASGDSLLGDAKNQVAAAASR
VALSAERQPPVVQGLVKNVVNSTTSSMMGSVRNQLNAAWISDVVSVYRQSLAGRYPIAAGSSRDATLEDF
GHFFGAGGVMDSYFRQYLQPYVDTSASTWRWQPGAAQKLGINPGVLHTFQRAAAIRDAFFRSGGMQPAVR
FELKPVTMDAAISQFILDLDGQQLTYDHGPARPVAMQWPSANGLGVVRLTVTPPPSSGRSGLTLEGPWAW
FRLLDQSDLERGNSPDRFTLRLRIDGSSIACELRASSAFNPFKSRVVSGFSLPERL
 
Nucleotide Sequence: 3531 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c93476-89946 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAAAGGCTTCCTCAACTTCTTCGCGCGCTGGGTGGTGCCGGTGCTCGGCCTGCTCGCCCTGAGCCTGA
TCATCTGGTTCCTCGGCCCGCTGCTGCGCCTGGGCAACTACGAACCGCTGGCCTCGGCGACCAGCCGCTG
GGTGCTGATCGTCCTGCTGTTCCTGGTCTGGATCGGCTTCCGCGTGCTGCGCATCGTGCAGGCCCGGCGC
AACGCGGCGAAGGTCATGCAGAGTCTCGCCGAGGTCAGCGCGCCGGACGCCGCCAGCGTCGCCACCGCCG
AAGAGCTGGCGACCCTCAAGCAACGCATGGACGAGGCCCTGGCCCTGCTCAAGCGGGCCAAGTTGGGCGG
CAGCGAGCGGCGCAACCTGTACGAGTTGCCCTGGTACGTGATCATCGGCCCGCCCGGTTCGGGCAAGACC
ACCGCGCTGATGAATTCCGGCCTCGACTTCCCGCTCGCCGCGCAGATGGGCGCCGGGGCGATCCGCGGGG
TCGGCGGCACGCGCAACTGCGACTGGTGGTTCACCGACGAAGCGGTGCTGCTGGACACCGCCGGCCGCTA
TACCACCCAGGACAGCCACGCCCAGGTGGACAAGGCCGCCTGGCTGGGCTTCCTCGACCTGCTCAAGACC
CAGCGCAAGCGCCGCCCCATCGATGGCGCGTTCATCGCCATCAGCCTTTCCGACCTGCTGCTGGGCAGCG
ACGCCGAGCGCGCCGCCCATGCCCAGGCGATCCGCGCACGCATCCAGGAGCTGTACCAGCAGCTCGGGGT
GCGCTTCCCGATCTACGTGATGCTGACCAAGTTCGACCTGGTGCCGGGCTTTATGGAGTTCTTCGACAGC
CTGAACCGCGAGGAACGCGCGCAGGTCTGGGGGATGACCTTCGCCCTCGACGACGGCAAGAGCGCGGAAG
GCCCGCTGGCGGTGTTCGACAGCGAATTCGCCCTGCTCGAACAGCGTCTCACCGCGCGCCTGGTGGAACG
CCTGCAGCAGGAGCGCGACCCGGCGCGGCGCGACCTGGTCTACGGCTTCCCGCAGCAATTCGCCGCCCTG
CGCGAATGCCTCGGCGAGTTCCTCAACGGCGTGTTCAAGCCCAACCCCTACGAGGAACGCCCGCTGTTGC
GCGGCCTGTACTTCACCAGCGGAACCCAGGAAGGCAGTCCGATCGACCGCCTGATCGGCAGCATGGCGCA
GTCGATGAACCTCGACCGCCAGCACCTGGCACGGCAGACCGGAACCGGGCGCAGCTACTTCATCGAGCGG
CTGTTCCGCGAAGTGGCGTTCGGCGAACGCGGCCTGGTCGGCACCAACCCGAAGGTCGAGCGCCGCCGCA
AGTGGCTGACCATCGGCGCGCTGAGCGCCACCGCGCTGGTGGTGCTGGCGGTGACGGCGGTATGGATCGC
CAGCTACCGCGCCAATCAGAGCTACATCGCCGCGGTCGACCAGCGCGTCGACCCGCTGGCGCGCGGCATC
GAGTCGCTGAGCCCGGCCCAGCGCGACGTCCTGGCCGTACTGCCACAGCTCAACGCGGTGCAGAATCTCG
CCGGCGACGCGCCGAGCTGGGCCGAAGGCTACGGGCTGTACCAGGGCGACATGCTCGGCGAGGAGTCCGC
CAGCGTCTACCGCAAGCTGCTGATCGCGGTGTTCGCCCCGCGCCTGGTGACCCGCATCGAGGAACAGTTG
CGCTCCGGCGGCAGCAGCGATTTCCTCTACGAGGGCCTGAAGGCCTACCTGATGCTCGGCAGCCCGGACC
ATTACGACGCCGACTTCATCAAGGCCTGGATCAGCCTCGACTGGGAACGCAACCTGCCGCGCGACCTCTC
GCCGGAACAGCGCCAGGCGCTGCACGCGCACCTCGACGCGTTGCTCGAACGACGGCCGCCGTCGGCGCGC
CTGGACCAGGACCTGGTCGAGGACCTGCGCCGCCAGTTGCAGCAACTGCCGGTGGCGCAGCGGGTCTACG
ACCGGGTCAAGCGGCAGAGGCTGCCCAAGGACGTGCCCGACTTCCGCATCAGCGACGCCGCCGGCCGCGA
CGCGCCGCTGGTGTTCGCGCGCAAGAGCGGCAAGCCGCTCACCGACCCGCTCAGCGGCTTCTTCACCTAC
CGCGGCTATCGCGAGGTGTTCCTCACCGCCAGCCTCAGCCAGGCCGGCACCATCGCCGAGGAACAGTGGG
TGCTCGGGCGCGACCTGAACGATGCCGGCGACGCCGCCAACCTGGCCCTCGACGTGCGTCGCCTGTATTT
CCAGGACTACCTGCGGCAGTGGGACGACCTGCTCGCCGACCTCACCGTGGTGCCGATCACCAATGTCACC
CAGGCCGCCGACGTGCTGCGCATTCTCTCCGGACCGACCTCGCCGTTCCGCAAGCTGCTCGAGGCAGTGG
CCCGCGAGACCGACCTGCAGAAGGGCGACCGGCTGGTCGCCGCGCAAGTGAAGAAGGCCGCCGACGGCAC
CGTGGACAAGCTCAAGCAGCGCCTCGGCTCGCTGGTCGGCCAGGAGGAAGAGGGCGCCCGCGAACAGCCG
CGGCAGGTCGACAGCGACCCGATCAGCGCCCACTTCGCCGAACTCAACAGCCTGGTCAGCAAGGGCGAGG
GCGGCAACGAGCCGGCGCCGATCGACAGCCTGCTGGAGGACATGAACGCGCTCTACGTACAGGTCAGCGC
CATGGCCGGAGCCAGCGGCGACTCGCTGCTCGGCGACGCCAAGAACCAGGTGGCCGCCGCCGCCTCGCGC
GTGGCCCTCAGCGCCGAGCGCCAGCCGCCGGTGGTCCAGGGCCTGGTGAAGAACGTGGTCAACTCCACCA
CCAGCAGCATGATGGGCAGCGTGCGCAACCAGCTCAACGCGGCCTGGATAAGCGATGTGGTCAGCGTCTA
CCGGCAGTCCCTGGCCGGGCGCTACCCGATCGCCGCCGGCAGCTCGCGCGACGCCACCCTGGAAGACTTC
GGCCACTTCTTCGGTGCCGGTGGGGTGATGGACAGCTACTTCCGCCAGTACCTGCAACCCTACGTCGACA
CCTCCGCCAGCACCTGGCGCTGGCAGCCCGGCGCGGCGCAGAAGCTCGGCATCAACCCCGGCGTGCTGCA
CACCTTCCAGCGCGCGGCGGCGATCCGCGACGCCTTCTTCCGCTCCGGCGGCATGCAGCCGGCGGTGCGC
TTCGAACTCAAGCCGGTGACCATGGACGCGGCGATCAGCCAGTTCATCCTCGACCTCGACGGCCAGCAGC
TGACCTACGACCACGGCCCCGCCCGCCCGGTGGCGATGCAGTGGCCGAGCGCCAACGGCCTCGGCGTGGT
CCGCCTGACGGTGACGCCGCCGCCCAGCAGCGGCCGTTCCGGCCTGACCCTGGAGGGCCCCTGGGCCTGG
TTCCGCCTGCTCGACCAGTCGGACCTGGAACGCGGCAACTCGCCGGACCGCTTCACCCTGCGGCTGCGCA
TCGACGGCTCCAGCATCGCCTGCGAGCTGCGCGCCAGCAGCGCCTTCAACCCCTTCAAGAGCCGGGTCGT
GTCCGGCTTCAGCCTCCCGGAGCGCCTTTGA
 Primer design