SecReT6
Protein ID: 386058743
SecReT6 ID612
T6SS typei4a
Gene symbol-
Locus tagPAM18_2680
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]2981490..2985305 [+]
Producthypothetical protein
NoteTssM
UniProt IDG2L1E1
KEGG IDpaf:PAM18_2680
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.00E-35, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|386058743|ref|YP_005975265.1| hypothetical protein PAM18_2680 [Pseudomonas aeruginosa M18]
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCSTWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPMARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGLEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVDNELYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAGAAADEVLPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVSQAPRWR
FTSLAFPSSWFSSLDARIDNAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLERHNRLFAQAIDNRRTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAERPADLAAL
DLGRVAATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGIGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGNRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
TLKLADDLLGLKRAIDDLKTKDFVSVALADKTLADHSLLSIDDIGVTQALSFFNDFTGYYESTLPSLNPR
YRYSVLHAAASAATEAMWQSLGPRSRSLASRNASRFDVQVKQVQVLQAALLELQDLQAGARLLLSLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQMFRAQDSAELKQSLNSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLKLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQRWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGTP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|386056071|ref|NC_017548.1|:2981490-2985305 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAGCGGCGCGACCCTGTTCATGCTGGTTCTCCTCCTGGTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGGACCCGGGGCGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCCTGGCTGCTGATGCTCGGCAACGAGACCGAGGGCGAG
CAGTTGTGCTCCACCTGGCGTCTGCTGCCGGTGGCGCGCCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGTGGCAGGCGCGCGCTGGACGGAGTGGTCTGG
AACATTCCGATGGCGCGGTTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCGCGCCGTCGCT
ACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTTTACGTGGTGATCACTGGCCTGGAAGACCT
GCCGGGTTTCCAGGAACTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAAGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGGACAATGAGCTGTATTGCCTGCCGCC
ACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGCAACGCCAGGGGC
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGCGCGGCAGCCGACGAAGTCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAGCTGCGTCAGCGCTGGCAGCGCGGGATCGGC
CTCGCCGCGTTGTGCCTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGCGACGCGCTGCGCG
ACGCCGGTGAACTGTCGCAACTGCTGCATGGCGCCAGTGAGCGCTACCAGCCGCTCGACGACGACACTCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGTCACAGGCGCCGCGCTGGCGC
TTCACTTCGCTGGCGTTTCCCAGTTCCTGGTTTTCCTCCCTGGATGCACGTATCGACAACGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTGCGACCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGATGGCCAACCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACGCTGGAGCGCCACAATCGCTTGTTCGCCCAGGCCATCGACA
ACCGCAGGACGCCGCTCGACGACCTTCTGCAACTGAGTAACGATGCCTTGGGCAGCAGCTACAACGCCGG
CAGCCTGGCGCGCCTGGCCTATTACAACCGCACGCTGTTCGCCGAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGCCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCACGCTGGCTGAACGCCT
ACTTCCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGACGCCACGGCGGCCCAGTTGCTGGGGATCGGCGAATTGATCAACCACCTGCAGCAACAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCTTGCTGGGAAACCGCGTGGAGGAACTGCAGAACCTCACCGTGCAGTTGCAGCA
GCAGTTTCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAACAGGGGGCG
ACGCTCAAGCTGGCCGATGACCTGCTCGGTCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCCGTGGCCCTGGCGGACAAGACACTGGCGGACCACTCCTTGCTGAGCATCGACGATATCGGCGTGAC
TCAGGCGTTGAGCTTCTTCAACGACTTCACCGGCTACTACGAGAGCACCCTGCCATCGCTCAACCCGCGC
TATCGCTATTCGGTCCTGCACGCCGCCGCCAGCGCGGCGACCGAGGCCATGTGGCAAAGCCTCGGGCCGC
GCAGTCGTAGCCTGGCCAGTCGCAATGCCTCGCGTTTCGACGTGCAGGTCAAGCAGGTCCAGGTGTTGCA
GGCGGCGCTGCTGGAGTTGCAGGACCTGCAGGCCGGCGCGCGCCTGCTGCTCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GCCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGATGTTCCGCGCCCAGGACAGTGCCGAGCTGAAGCA
AAGCCTGAACAGCCAGTTCAATGCCATGGCGGCCGTCGCCGAACGCCACGCCCCGGCGCTGGAGTGGTTG
CAGGCGCAGCAATCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGTTGGCGAAGCTGGTGGGTAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCCGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCGTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGAAACTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAGCAGGCGCAGCGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGTTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAATGTCGGCG
ATCCGCTGAAAATCATGCTGCGCTGGGCGAAGAACGGCTCGCAGCGTCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGTTGCGCATGATG
CGCGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCGCCCTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACGGGAGGTACCCCATGA
 Primer design