SecReT6
Protein ID: 386059439
SecReT6 ID613
T6SS typei1
Gene symbolstk1
Locus tagPAM18_3376
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]3755570..3756559 [-]
Productserine-threonine kinase Stk1
NoteStk1
UniProt IDG2LA77
KEGG IDpaf:PAM18_3376
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.20E-40, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 4.60E-25, Aligned region: 53..306
APH [PF01636], Evalue: 4.70E-05, Aligned region: 97..176
APH [PF01636], Evalue: 4.70E-05, Aligned region: 171..203
APH [PF01636], Evalue: 4.70E-05, Aligned region: 228..305
RIO1 [PF01163], Evalue: 0.0028, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|386059439|ref|YP_005975961.1| serine-threonine kinase Stk1 [Pseudomonas aeruginosa M18]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDVLAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c3756559-3755570 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGGACGGTCTACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGCTGAAGCTGCTCAACGAGTCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCATGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGACCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGCTGAGCGCGATCG
CCCGGCCGTTGCTGGATGTTCTGGCCTACGTCCACGAACAAGGAGTACTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAAGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGATGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACTCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGCGCGCCATTGTCGCCGGCGGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design