SecReT6
Protein ID: 386059440
SecReT6 ID613
T6SS typei1
Gene symbolstp1
Locus tagPAM18_3377
StrainPseudomonas aeruginosa M18
Repliconchromosome [GenBank: NC_017548] [Browse all T6SS(s) in this replicon]
Location [Strand]3756556..3757284 [-]
Productserine/threonine phosphoprotein phosphatase Stp1
NoteStp1
UniProt IDG2LA78
KEGG IDpaf:PAM18_3377
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 3.50E-16, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 5.70E-11, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|386059440|ref|YP_005975962.1| serine/threonine phosphoprotein phosphatase Stp1 [Pseudomonas aeruginosa M18]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|386056071|ref|NC_017548.1|:c3757284-3756556 Pseudomonas aeruginosa M18 chromosome, complete genome
ATGCAACGCACCGAACCCTGGCGCAGCGCGGCACGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGCGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGGGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGCGACAGGATCATCGGCAGTACGGTGGTGGCGCTGGTCGTGGAGGGTTCGCGGGCGGCCTGCGT
GTGGGTCGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGCTGTACCAGCTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAGCAGGCCCGCGCCTATCCCTCGGCGCGCG
CGCTGACCCGTGCCGTCGGCGCTAGCGAACAACTGGTGCTGGACGTGTTGGAACTGGAGGTGCATCCCGG
TGATGTCTTCCTGCTCTGCAGCGACGGGCTCTACGAAGAGCTGAGCGCCGATGCGCTGGGTCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGTGCCCTGAGCGGCGCCGCACGGGACA
ACCTGACGGCAGTGGTGATCCGCCAATGA
 Primer design