SecReT6
Protein ID: 386065507
SecReT6 ID615
T6SS typei1
Gene symbolstp1
Locus tagNCGM2_2568
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2754590..2755318 [+]
Productserine/threonine phosphoprotein phosphatase
NoteStp1
UniProt IDG4LBD9
KEGG IDpnc:NCGM2_2568
PDB IDNA
Domain hit(s) vs Pfam PP2C_2 [PF13672], Evalue: 1.10E-16, Aligned region: 19..204
PP2C [PF00481], Evalue: 3.50E-16, Aligned region: 31..234
SpoIIE [PF07228], Evalue: 5.70E-11, Aligned region: 35..241
Protein Sequence: 242 a.a.     [Download]
>gi|386065507|ref|YP_005980811.1| serine/threonine phosphoprotein phosphatase [Pseudomonas aeruginosa NCGM2.S1]
MQRTEPWRSAARTDRGKVRARNEDAFLDCPDRGLWAVADGMGGHQAGDLASRMIVTSLAELPARAGFDER
LNAMRQCLHWLNRRLGEELTLSAERGDRIIGSTVVALVVEGSRAACVWVGDSRCYLWRGQRLYQLSRDHS
LLQRLVDERRMDIEQARAYPSARALTRAVGASEQLVLDVLELEVHPGDVFLLCSDGLYEELSADALGRAL
SLASPQVAVERLFDGALSGAARDNLTAVVIRQ
 
Nucleotide Sequence: 729 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2754590-2755318 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGCAACGCACCGAGCCCTGGCGCAGCGCGGCGCGCACGGATCGCGGCAAGGTCCGCGCGCGCAACGAGG
ATGCCTTCCTGGACTGCCCGGATCGCGGGCTCTGGGCGGTCGCCGATGGCATGGGCGGGCACCAGGCCGG
CGACCTGGCCAGCCGGATGATCGTCACCAGCCTGGCGGAACTGCCGGCCCGGGCGGGATTCGACGAGCGC
CTGAACGCGATGCGCCAGTGCCTGCACTGGCTCAACCGGCGCCTGGGCGAGGAACTCACCCTCAGCGCCG
AACGCGGCGACAGGATCATCGGCAGTACGGTGGTGGCGCTGGTCGTGGAGGGTTCGCGGGCGGCCTGCGT
GTGGGTCGGCGACAGCCGCTGCTACCTGTGGCGCGGCCAGCGGCTGTACCAGCTGTCCCGCGACCACTCG
CTGTTGCAGCGACTGGTCGACGAACGGCGGATGGATATCGAACAGGCCCGCGCCTATCCCTCGGCGCGCG
CGCTGACCCGTGCCGTCGGCGCCAGCGAACAACTGGTGCTGGACGTGTTGGAACTGGAGGTGCATCCCGG
TGATGTCTTCCTGCTCTGCAGCGACGGGCTCTACGAAGAGCTGAGCGCCGATGCGCTGGGCCGCGCGTTG
AGCCTGGCATCGCCGCAGGTGGCGGTGGAGCGGCTGTTCGACGGCGCTCTGAGCGGCGCCGCGCGGGACA
ACCTGACGGCCGTGGTGATCCGCCAATGA
 Primer design