SecReT6
Protein ID: 386065508
SecReT6 ID615
T6SS typei1
Gene symbolstk1
Locus tagNCGM2_2569
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]2755315..2756304 [+]
Productserine-threonine kinase
NoteStk1
UniProt IDG4LBE0
KEGG IDpnc:NCGM2_2569
PDB IDNA
Domain hit(s) vs Pfam Pkinase [PF00069], Evalue: 4.30E-41, Aligned region: 51..286
Pkinase_Tyr [PF07714], Evalue: 7.10E-26, Aligned region: 53..306
APH [PF01636], Evalue: 6.10E-05, Aligned region: 97..176
APH [PF01636], Evalue: 6.10E-05, Aligned region: 164..203
APH [PF01636], Evalue: 6.10E-05, Aligned region: 228..305
RIO1 [PF01163], Evalue: 0.0046, Aligned region: 128..202
Protein Sequence: 329 a.a.     [Download]
>gi|386065508|ref|YP_005980812.1| serine-threonine kinase [Pseudomonas aeruginosa NCGM2.S1]
MNEPLSSLELLPEEEGGANLTYFAFAAPTASAPDLPAVLPGPLPDVLSGRYRLERMLGAGGMGTVYRARD
LLHEQFGDPAPLVALKLLNESVAESPDASALLYSEFALTRRLRHPNVVRLFTFDVDTACQRAYIVMELMP
GLPLDRLLCERPEGLPWSELSAIARPLLDALAYVHEQGVLHGDLKPSNVMLGEEGVRLFDFGLGQAQAGI
LDGLPQLSRGRIDAWTPGYAAPELLEGAPLSPAADLYALACVLYELADGRHPFRRLPSNQAREQGLERQL
RAPGHLPRRCWPALRTALSLDPERRCIGVRELQEALGARRSWLAGVLAR
 
Nucleotide Sequence: 990 bp     [Download]
>gi|386062973|ref|NC_017549.1|:2755315-2756304 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGAACGAACCGCTGTCGTCGCTGGAGCTGCTGCCGGAGGAGGAGGGCGGCGCGAACCTGACCTATTTCG
CCTTCGCCGCCCCGACCGCCTCGGCGCCGGACCTGCCGGCGGTGTTGCCCGGTCCGCTGCCGGACGTTCT
TTCCGGGCGCTACCGTCTGGAGCGGATGCTCGGCGCCGGCGGCATGGGCACGGTATACCGTGCCCGGGAC
CTGCTCCATGAGCAGTTCGGCGACCCGGCGCCGCTGGTAGCGTTGAAGCTGCTCAACGAATCGGTCGCCG
AGTCACCCGACGCCAGCGCCTTGCTCTATAGCGAGTTCGCCCTGACCCGGCGCTTGCGCCATCCGAACGT
CGTGCGTCTGTTCACCTTCGACGTCGACACCGCCTGCCAGCGCGCCTACATCGTCATGGAACTCATGCCT
GGCCTGCCGCTCGATCGCCTGCTCTGCGAGCGTCCCGAAGGCCTGCCCTGGTCCGAGTTGAGCGCGATCG
CCCGGCCGTTGCTGGACGCCCTGGCCTATGTCCACGAACAAGGGGTGCTGCATGGCGACCTGAAGCCGAG
CAACGTGATGCTCGGCGAGGAGGGCGTGCGGCTCTTCGACTTCGGCCTCGGCCAGGCGCAGGCAGGCATC
CTGGACGGCCTGCCGCAGCTCAGCCGGGGCCGCATCGACGCCTGGACCCCGGGCTACGCCGCTCCCGAAC
TGCTCGAGGGTGCGCCGTTGTCGCCGGCAGCCGACCTGTATGCGCTGGCCTGCGTCCTCTACGAACTGGC
CGACGGTCGCCATCCGTTCCGCCGCCTGCCCTCGAACCAGGCCCGGGAGCAGGGGCTGGAGCGCCAGCTG
CGCGCGCCCGGACACCTGCCTCGGCGCTGCTGGCCGGCGCTGCGTACCGCCCTGAGCCTCGACCCCGAAC
GGCGCTGCATCGGCGTCCGCGAATTGCAGGAAGCGCTGGGCGCGCGGCGTTCCTGGCTGGCCGGCGTTCT
TGCCCGTTGA
 Primer design