SecReT6
Protein ID: 386066300
SecReT6 ID616
T6SS typei4a
Gene symbol-
Locus tagNCGM2_3371
StrainPseudomonas aeruginosa NCGM2.S1
Repliconchromosome I [GenBank: NC_017549] [Browse all T6SS(s) in this replicon]
Location [Strand]3606516..3610331 [-]
Producthypothetical protein
NoteTssM
UniProt IDG4LI83
KEGG IDpnc:NCGM2_3371
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 1.00E-34, Aligned region: 114..354
Protein Sequence: 1271 a.a.     [Download]
>gi|386066300|ref|YP_005981604.1| hypothetical protein NCGM2_3371 [Pseudomonas aeruginosa NCGM2.S1]
MSGATLFMLVLLLVLLALLLGALGWWWRTRGGTEIRSFYAAVRQMEREQGWQGRYEAPWLLMLGNETEGE
QLCATWRLLPVARPAWFGRWWSDGEGAILLVPESVFLPDEGLRRQSGAWLRLLRLFLRLRGRRALDGVVW
NIPLARLQDGEQAANLGLAARRRYVELTQRLGLSLPVYVVITGLEDLPGFQELLAALPEEARERALGWSS
PFAAEAAWQSRWCEQALEEITATLTESIVELGTLRGQVNNDLYCLPPRLESLRGSLQALLEPVFQGNARG
EAPRFRGLYLSGSEAAGAASDEALPAVDAPRRRSSFASQLWARRILAEEGLAQAVPRILQLRQRWQRGIG
LAALCLCLLWGGLMTWVWRDALRDAGELSQLLHGASERYQPLDDDTRRAAQVRQNVQAWWQLVAQAPRWR
FTSLAFPSSWFSSLDARIDSAYRRVSERLLVRPLRSLLEGEASDLRAIRSDGQPGLKEGDDPSQWKDYLA
AKDLVARATTLERHNRLFAQAIDNRKTPLDDLLQLSNDALGSSYNAGSLARLAYYNRTLFAKRPADLAAL
DLGRVGATAADNFHDLMARWLNAYFLTDSLERTGNALTQELAQLGQERDATAAQLLGVGELINHLQQQVN
RINLIWGNGVGQDLVPGYQNLLKSAQQSSLLGDRVEELQNLTVQLQQQFRSEWIAPPEAAGDGLLVKQGA
TLKLADDLLGLKRAIDDLKTKDFVSVALAGKTLAEHSLLSIDDIGVTQALSFFNDFSGYYESTLPSLNPR
YRYSVLHAAASATTEAMWQSLGPRSRSLTSRNASRFDVQVKQVQALQAALLELQDMQAGARLLASLNALA
VADIGQALRDIDEQAVLREPVDFSRWSGAPNFGLQAFRAQDSAELKQSLTSQFNAMAAVAERHAPALEWL
QAQQSSLATADYNAFVRFSALNAELQKFKADNPASTAAQLAKLVGNDFNQMDIGSCADILNGVLLPSSRS
DLATRLVDLRQGALGRCQSLQQQQAAQAWKDLADYFNQYLAGRFPFAYSLEAADAEPGRVRHLLKLMETR
LPQVREGLAQVRSPDLPAAEDFVRRLEQAQGWLGPLFERDKSGLLGVALDIDWRSDRSLERGADQVIAWS
LYSGDQESRFPGAQDKGLTWNVGDPLKIMLRWAKNGSQRPADDPRQASLAVADLEAGWSYQGSWALLRMM
RAHFSRQRPPNVDYTEFPLVLQLPVYAPYSPENEARMFLRLSLMSLGGKTPLSIQPLPVRAPQSPFATLL
PATVASTGGIP
 
Nucleotide Sequence: 3816 bp     [Download]
>gi|386062973|ref|NC_017549.1|:c3610331-3606516 Pseudomonas aeruginosa NCGM2.S1 chromosome 1, complete genome
ATGAGCGGCGCGACGCTGTTCATGCTGGTTCTCCTCCTGGTGCTGCTGGCGCTGCTGCTGGGGGCGCTGG
GCTGGTGGTGGCGGACCCGGGGCGGTACGGAGATCCGCAGCTTCTACGCGGCGGTCCGGCAGATGGAGCG
CGAGCAGGGCTGGCAGGGCCGCTACGAAGCGCCGTGGCTGCTGATGCTAGGCAACGAGACCGAGGGCGAG
CAGTTGTGCGCCACCTGGCGCCTGCTGCCGGTGGCGCGTCCGGCCTGGTTCGGCCGCTGGTGGTCGGACG
GCGAGGGGGCGATCCTGCTGGTGCCCGAGTCGGTGTTCCTGCCCGACGAGGGCCTGCGCCGGCAAAGCGG
CGCCTGGCTGCGCCTGTTGCGTCTGTTCCTGCGCCTGCGCGGCAGGCGCGCGCTGGACGGAGTGGTCTGG
AACATTCCGCTGGCGCGGCTGCAGGATGGCGAGCAGGCGGCCAACCTCGGCCTCGCCGCCCGTCGTCGCT
ACGTGGAACTGACCCAGCGCCTTGGCCTGAGCCTGCCGGTTTACGTGGTGATCACTGGCCTGGAAGACCT
GCCGGGTTTCCAGGAGCTTCTCGCGGCGCTGCCCGAGGAGGCGCGCGAGCGCGCCCTCGGCTGGTCCTCG
CCGTTCGCCGCCGAAGCGGCCTGGCAGTCGCGCTGGTGCGAGCAGGCGCTGGAGGAAATCACCGCCACCC
TGACCGAGTCGATCGTCGAACTCGGTACCTTGCGCGGCCAGGTGAACAACGACCTGTATTGCCTGCCGCC
ACGCCTGGAAAGCCTCCGCGGTTCGTTGCAGGCGCTGCTCGAACCGGTCTTCCAGGGTAACGCCAGGGGT
GAGGCGCCGCGCTTTCGCGGTCTCTACCTGAGCGGCAGCGAGGCGGCGGGGGCGGCAAGCGACGAAGCCC
TGCCGGCGGTCGACGCGCCGCGTCGGCGCAGCAGCTTCGCCAGCCAACTGTGGGCACGGCGGATCCTTGC
CGAGGAAGGCCTGGCCCAGGCGGTGCCGCGCATCCTCCAGCTGCGCCAGCGCTGGCAGCGCGGTATCGGC
CTCGCTGCGCTGTGCCTGTGCCTGCTCTGGGGCGGCCTGATGACCTGGGTCTGGCGTGACGCGCTGCGCG
ACGCCGGCGAACTGTCGCAACTGCTGCATGGCGCCAGCGAGCGCTACCAGCCGCTCGACGACGACACCCG
GCGCGCCGCCCAGGTCCGGCAGAACGTCCAGGCCTGGTGGCAACTGGTGGCACAGGCGCCGCGCTGGCGC
TTCACCTCGCTGGCGTTCCCCAGTTCTTGGTTTTCCTCCCTGGACGCACGCATCGACAGCGCGTATCGCC
GCGTTTCCGAGCGCCTGCTGGTACGCCCGCTGCGCAGCCTGCTGGAAGGCGAGGCGAGCGACCTGCGGGC
GATCCGCAGCGACGGCCAGCCCGGCCTGAAGGAGGGCGACGACCCCAGCCAGTGGAAGGACTACCTGGCG
GCGAAGGACCTGGTCGCCCGCGCCACTACCCTGGAGCGCCACAATCGCCTGTTCGCCCAGGCCATCGACA
ACCGCAAGACGCCGCTCGACGATCTCCTGCAACTGAGTAACGATGCCTTGGGCAGCAGCTACAACGCCGG
CAGCCTGGCGCGCCTGGCCTATTACAACCGCACGCTGTTCGCCAAGCGTCCGGCCGATCTCGCCGCCCTC
GACCTGGGCCGGGTCGGCGCCACGGCGGCGGATAACTTCCATGACCTGATGGCCCGCTGGCTGAACGCCT
ACTTTCTCACCGACAGCCTGGAACGCACCGGCAATGCCCTGACCCAGGAACTCGCGCAGCTCGGCCAGGA
ACGAGATGCCACGGCGGCCCAGTTGCTGGGGGTCGGCGAATTGATCAACCACCTGCAGCAGCAGGTCAAC
CGCATCAACCTGATCTGGGGCAATGGCGTCGGCCAGGATCTCGTCCCTGGCTACCAGAACCTGCTCAAGA
GCGCCCAGCAAAGCAGCCTGCTGGGAGACCGCGTGGAGGAACTGCAGAACCTCACGGTGCAGTTGCAGCA
GCAGTTCCGCAGCGAATGGATCGCGCCTCCGGAGGCTGCCGGCGACGGCCTGCTGGTGAAGCAGGGGGCG
ACGCTCAAGCTGGCCGATGACCTGCTCGGCCTGAAACGCGCCATCGATGACCTGAAGACCAAGGACTTCG
TCTCGGTGGCCCTGGCCGGCAAGACGCTGGCGGAGCACTCCCTGCTGAGCATCGACGACATCGGCGTGAC
CCAGGCGTTGAGCTTCTTCAACGACTTCAGCGGCTACTACGAGAGCACCCTGCCGTCGCTCAACCCGCGC
TATCGCTACTCGGTCCTGCACGCCGCCGCCAGCGCGACGACCGAGGCCATGTGGCAAAGCCTCGGGCCGC
GCAGTCGCAGCCTGACCAGCCGCAATGCCTCGCGCTTCGACGTGCAGGTCAAGCAGGTCCAGGCATTGCA
GGCGGCGCTGCTGGAGTTGCAGGACATGCAGGCCGGCGCGCGCCTGCTGGCCAGCCTCAACGCGCTGGCC
GTGGCCGATATCGGCCAGGCCCTGCGCGACATCGACGAGCAGGCGGTGCTGCGCGAGCCGGTCGATTTCA
GTCGCTGGTCGGGCGCGCCGAATTTCGGCCTGCAGGCGTTCCGCGCCCAGGACAGCGCCGAGCTGAAGCA
GAGCCTGACCAGCCAGTTCAATGCCATGGCCGCGGTCGCCGAGCGCCACGCCCCGGCGCTGGAGTGGCTG
CAGGCGCAGCAGTCCAGCCTGGCCACCGCCGACTACAACGCGTTCGTGCGCTTCAGCGCGCTCAACGCCG
AACTGCAGAAATTCAAGGCCGACAACCCGGCGAGCACCGCGGCGCAGCTGGCGAAGCTGGTGGGTAACGA
TTTCAACCAGATGGACATCGGCAGTTGCGCTGACATTCTCAACGGCGTGCTCCTGCCGTCCAGCCGCAGC
GACCTGGCGACGCGCCTGGTGGACCTGCGCCAGGGCGCGCTCGGGCGCTGCCAGTCGTTGCAACAGCAGC
AGGCGGCGCAGGCCTGGAAGGACCTCGCCGACTACTTCAACCAGTACCTCGCCGGACGCTTCCCGTTCGC
CTACAGCCTGGAAGCGGCCGATGCCGAGCCGGGGCGGGTGCGGCACCTGCTGAAGCTGATGGAGACGCGC
TTGCCGCAGGTGCGCGAAGGGCTGGCCCAGGTTCGCTCGCCGGACCTGCCGGCCGCCGAGGACTTCGTCC
GCCGCCTGGAACAGGCGCAGGGCTGGCTCGGCCCGCTGTTCGAGCGCGACAAGTCGGGCCTGCTCGGCGT
CGCCCTGGACATCGACTGGCGCAGCGACCGCAGCCTGGAACGCGGCGCCGACCAGGTGATCGCCTGGAGC
CTGTACTCGGGCGACCAGGAAAGCCGGTTCCCCGGCGCGCAGGACAAGGGCCTGACCTGGAATGTCGGCG
ATCCGCTGAAAATCATGCTGCGCTGGGCGAAGAACGGTTCGCAGCGTCCGGCAGACGACCCGCGCCAGGC
CAGCCTGGCGGTGGCCGACCTCGAGGCCGGCTGGAGCTACCAGGGCTCCTGGGCGCTGCTACGCATGATG
CGCGCGCACTTCTCCCGGCAGCGCCCGCCGAACGTCGACTACACGGAGTTTCCGCTGGTCCTGCAACTGC
CGGTGTATGCGCCCTACAGCCCGGAAAACGAGGCGCGGATGTTCCTCCGCCTGTCGTTGATGAGCCTGGG
CGGCAAGACCCCGCTGTCCATCCAGCCGCTGCCGGTGCGCGCGCCGCAATCGCCGTTCGCGACGCTGTTG
CCGGCCACCGTCGCCAGCACCGGAGGTATCCCATGA
 Primer design