SecReT6
Protein ID: 386078877
SecReT6 ID617
T6SS typei3
Gene symbol-
Locus tagPAGR_g1659
StrainPantoea ananatis PA13
Repliconchromosome [GenBank: NC_017554] [Browse all T6SS(s) in this replicon]
Location [Strand]1821435..1825061 [+]
Producttype VI secretion system protein IcmF
NoteTssM
UniProt IDG7UCD1
KEGG IDpaq:PAGR_g1659
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 9.80E-98, Aligned region: 208..486
IcmF-related [PF06761], Evalue: 1.00E-85, Aligned region: 535..841
DUF1215 [PF06744], Evalue: 7.70E-31, Aligned region: 861..888
DUF1215 [PF06744], Evalue: 7.70E-31, Aligned region: 950..1075
Xpo1 [PF08389], Evalue: 0.0092, Aligned region: 578..603
Xpo1 [PF08389], Evalue: 0.0092, Aligned region: 633..665
Xpo1 [PF08389], Evalue: 0.0092, Aligned region: 779..822
Protein Sequence: 1208 a.a.     [Download]
>gi|386078877|ref|YP_005992402.1| type VI secretion system protein IcmF [Pantoea ananatis PA13]
MLNVLFAVLTSRLAWGFVGITALSFIIWVIGPVFSIVDSRPLESEQNRVISIALLYVVWGLSQAIPRVYN
YWLNRKLMSSLETSKSDTPEEDRKRLTSEDQVLASRFSEATEMLKKAHFQRQSSKGAPFWAQRFSHQYLY
QLPWYMIIGAPGAGKTTALVNSGLQFPLADKFGKAALRGIGGTRNCDWWFTNEAVLLDTAGRYTTQESQQ
ERDAGEWHQFLDLLRKYRGRQPVNGVIVTLSVADLLSQSPEAMRNQAVALRQRLMELHDRLGIRFPVYVL
VTKTDLLKGFRSYFASLDKAQREQIWGFTFPWAKASTAEFELSSQFQQEYSLLQQRLDAGLADVLLAESD
AQARAESYLFPQEFAALRPQLAEALDILFARSDFETQFAPRGIYFASGTQEGLPFDRVMGELTRALHLPG
QQQSESGSWDKVDKDAPIPQNKGQSFFLKGVLENVIFQESGLAGSNRWWELRNRVGLWSGYLALLVIVLI
AGALWLVSYNKNKTYLQEMAAKSPQVEQLGDKLQKEVNGNLFALVPYLNTLLHLPESASFSLEHPPLTRR
MGLYRGTEVSDATQALYERALKQLLMPQVAQNITRWLRNDTGSDADYSYEALKAYQMLYQPKHYDGKFLQ
AWMMLNISRELPQDVTQAEVKQLAWHLQQLLETQIQSSPYAKDDALVKREQALISQMPLSQRVYGRLKRL
LERDGSMSPVTLSALGGPQSELVFSRKSGKSVNEGVSGLFTPDGYWNHVDKQIAPVTDALYKDDIWVLGA
ETAHEDSKQTDLAVRQLYIQDYIRQWEQFLSDIQLNSSADLTQRINTARLLSGNHSPLRQLVINLSKQLT
LTRAQPEDKNAKDTAASSDNSATRTLQALFTSPRANGEQAVVQQTPEQAVTAHFAPVIELAQPLQQGSKV
LAVDDFLKQIDDLYRYLTAVQDAANSGMPPPASDAISRLQASAGRLPGSLQNMVSGMAVGASSDAQRRDM
DNVRKRITMEVGSFCRQAIAGRYPLVRNARSEVTPDDLARMFAPGTGLMDSFFRDNLASKVDTTRAAWRF
TPGIDGKTLPGGEALLRPFQQAQSIRDAFFANGATTPSFRVTLRTVKMDNDILNMTLDVDGQILRYSHGP
QAVQLVSWPGPGGTSQVRMQLGLTNGTTSTLTTSGPWALNRFFDRARVTSVGGLTREASFSVDGHNVTLS
FTPGSIRNPFQLPAFSCP
 
Nucleotide Sequence: 3627 bp     [Download]
>gi|386077236|ref|NC_017554.1|:1821435-1825061 Pantoea ananatis PA13 chromosome, complete genome
ATGCTGAATGTACTATTTGCGGTACTGACCAGCCGTCTGGCCTGGGGCTTTGTCGGTATCACCGCACTTT
CGTTTATTATCTGGGTCATTGGCCCGGTGTTCTCGATTGTGGACTCCCGTCCGTTGGAGTCAGAACAGAA
CCGCGTAATCAGTATTGCGCTGCTCTATGTTGTCTGGGGCCTGAGCCAGGCGATTCCGCGTGTCTATAAC
TACTGGCTCAACCGTAAGCTGATGTCCAGCCTGGAAACCAGCAAATCGGATACGCCGGAAGAAGACCGCA
AGCGACTGACCAGTGAAGATCAGGTGCTGGCCAGCCGCTTCTCTGAAGCGACTGAGATGCTGAAAAAAGC
ACACTTCCAGCGGCAGAGCAGCAAAGGTGCGCCTTTCTGGGCGCAGCGCTTCAGTCATCAATATCTCTAT
CAACTGCCTTGGTACATGATCATCGGCGCGCCAGGTGCCGGTAAAACCACCGCTCTGGTGAATTCTGGCT
TGCAGTTCCCACTGGCGGACAAGTTCGGTAAGGCTGCGCTACGTGGGATCGGCGGGACGCGTAACTGTGA
CTGGTGGTTTACTAACGAAGCCGTGCTGCTGGATACGGCGGGGCGCTATACCACGCAGGAGAGCCAGCAG
GAGCGCGATGCCGGCGAATGGCATCAGTTTCTCGATCTCCTGCGTAAATACCGTGGCCGTCAGCCGGTTA
ACGGCGTCATCGTCACCTTGAGCGTGGCAGACCTGTTATCACAGTCGCCCGAGGCCATGCGCAATCAGGC
CGTGGCGCTGCGCCAGCGTCTGATGGAGTTACACGATCGGCTCGGTATTCGCTTTCCGGTGTATGTCCTG
GTCACCAAAACCGACCTGTTAAAGGGGTTCCGCAGCTATTTTGCCAGCCTGGATAAGGCACAGCGCGAGC
AGATTTGGGGCTTTACCTTTCCGTGGGCCAAAGCATCAACGGCTGAATTTGAACTCAGCAGCCAGTTTCA
GCAGGAATATTCGCTGCTGCAGCAGCGCCTGGATGCCGGACTTGCCGATGTGCTGCTGGCGGAAAGTGAT
GCCCAGGCACGTGCCGAAAGCTACCTGTTTCCACAGGAGTTTGCGGCATTGCGCCCTCAGTTGGCTGAGG
CGCTGGACATTCTGTTTGCGCGTTCCGATTTCGAAACGCAGTTCGCTCCGCGCGGCATCTACTTTGCCAG
CGGTACGCAGGAAGGCTTACCCTTTGACCGCGTAATGGGTGAACTGACGCGCGCCCTGCATCTGCCAGGC
CAGCAGCAGAGTGAGTCGGGCAGTTGGGACAAAGTGGATAAAGACGCGCCGATCCCTCAAAACAAAGGTC
AGAGCTTTTTTCTTAAGGGCGTGCTGGAAAATGTCATCTTCCAGGAGTCCGGTCTGGCCGGCAGTAACCG
CTGGTGGGAGCTACGTAACCGCGTGGGCCTGTGGTCGGGTTATCTGGCGTTACTGGTTATCGTACTCATT
GCCGGTGCACTGTGGCTGGTGAGCTATAACAAAAACAAAACCTACCTGCAGGAGATGGCGGCGAAAAGCC
CCCAGGTTGAGCAGCTCGGTGACAAGTTACAAAAAGAGGTGAACGGCAACCTCTTTGCACTGGTGCCTTA
CCTCAATACGCTGCTGCACCTGCCTGAAAGCGCCTCCTTTTCTCTGGAGCATCCGCCGCTCACGCGCCGG
ATGGGGCTATATCGCGGAACGGAAGTCAGTGATGCGACCCAGGCCTTGTACGAAAGGGCGCTGAAACAGC
TGCTGATGCCGCAGGTTGCGCAGAATATCACCCGCTGGTTACGCAATGATACGGGAAGTGACGCTGACTA
CAGCTATGAGGCGCTCAAGGCTTATCAGATGCTGTACCAGCCAAAACACTATGACGGTAAGTTTCTTCAG
GCGTGGATGATGTTAAACATCTCGCGTGAATTGCCGCAGGACGTGACTCAGGCAGAGGTGAAACAGCTGG
CGTGGCATCTGCAACAGCTACTGGAAACGCAGATTCAGTCCTCGCCCTATGCGAAGGATGATGCGCTGGT
AAAGCGCGAGCAGGCGCTGATTAGTCAGATGCCGCTGTCACAGCGCGTTTACGGACGCCTGAAACGCCTG
CTGGAACGCGATGGCTCAATGTCACCGGTTACCTTGTCCGCGCTGGGTGGACCGCAAAGTGAACTGGTGT
TTTCCCGTAAAAGCGGTAAGTCTGTCAATGAAGGTGTTTCCGGGCTCTTTACGCCAGACGGCTACTGGAA
CCATGTGGATAAACAGATCGCGCCAGTCACGGATGCGCTCTACAAAGACGATATCTGGGTGCTGGGTGCA
GAGACGGCCCATGAAGACAGCAAACAAACCGACCTTGCGGTGCGCCAGCTCTATATTCAGGATTACATCC
GCCAGTGGGAGCAGTTTCTCAGCGATATTCAACTCAACAGCAGCGCCGATTTGACCCAACGTATTAATAC
GGCGCGCCTGCTGTCAGGGAATCATTCGCCGCTGCGGCAGTTAGTGATTAACCTGAGCAAACAGCTCACG
CTCACCCGGGCGCAGCCTGAAGACAAGAATGCCAAAGATACGGCCGCGTCATCGGATAACAGCGCCACAC
GAACGCTGCAGGCACTGTTTACCTCGCCGCGCGCAAACGGCGAGCAGGCGGTGGTGCAGCAAACGCCTGA
GCAGGCGGTGACCGCGCACTTTGCACCTGTCATTGAGCTGGCACAGCCGTTACAGCAGGGCAGTAAGGTC
CTGGCCGTTGATGATTTTCTTAAGCAGATCGACGATCTCTATCGCTATCTCACCGCCGTGCAGGATGCCG
CGAATAGCGGTATGCCACCGCCGGCGAGTGATGCCATTAGCCGTTTGCAGGCCAGCGCCGGACGTTTGCC
CGGTTCACTGCAAAATATGGTGTCAGGCATGGCAGTGGGCGCCAGCAGCGATGCACAGCGTCGCGACATG
GATAACGTTCGCAAGCGCATCACCATGGAAGTCGGCAGCTTCTGCCGTCAGGCGATAGCAGGCCGTTACC
CGCTGGTCCGGAATGCACGCAGCGAAGTCACGCCTGATGACCTGGCGCGCATGTTTGCGCCGGGAACCGG
ACTGATGGACAGCTTCTTCCGCGATAATCTGGCCAGCAAAGTGGACACCACGCGCGCGGCATGGCGCTTC
ACGCCCGGCATTGATGGCAAAACCTTGCCAGGTGGCGAAGCCTTGCTGCGTCCTTTCCAGCAGGCGCAGT
CGATTCGCGACGCCTTCTTTGCCAATGGGGCCACTACGCCATCCTTCCGCGTCACGTTACGGACGGTGAA
GATGGATAACGATATCCTGAATATGACGCTGGATGTCGATGGACAGATTTTGCGCTACAGTCATGGACCA
CAGGCAGTGCAGTTAGTCAGTTGGCCCGGACCAGGTGGAACCAGTCAGGTGCGCATGCAACTGGGGCTAA
CGAACGGCACGACCTCAACCCTGACCACCAGCGGCCCATGGGCGCTTAATCGCTTCTTTGATCGCGCACG
GGTGACGTCGGTAGGTGGACTGACTCGCGAAGCCAGCTTTAGTGTGGACGGCCATAATGTGACGCTGTCA
TTCACGCCAGGCAGCATTCGTAATCCTTTCCAGCTACCCGCATTTAGCTGTCCCTGA
 Primer design