SecReT6
Protein ID: 386309007
SecReT6 ID618
T6SS typei3
Gene symbol-
Locus tagY11_15641
StrainYersinia enterocolitica subsp. palearctica Y11
Repliconchromosome [GenBank: NC_017564] [Browse all T6SS(s) in this replicon]
Location [Strand]1564079..1567912 [-]
Producticmf-related protein
NoteTssM
UniProt IDE7B4M9
KEGG IDyey:Y11_15641
PDB IDNA
Domain hit(s) vs Pfam IcmF-related [PF06761], Evalue: 3.70E-85, Aligned region: 583..898
ImcF-related_N [PF14331], Evalue: 8.40E-71, Aligned region: 251..535
DUF1215 [PF06744], Evalue: 5.80E-29, Aligned region: 627..642
DUF1215 [PF06744], Evalue: 5.80E-29, Aligned region: 1014..1127
Protein Sequence: 1277 a.a.     [Download]
>gi|386309007|ref|YP_006005063.1| icmf-related protein [Yersinia enterocolitica subsp. palearctica Y11]
MSYLNRLFSGWAMKRILLVGCFLLLAAAIWFLGPFLGFGETRPLEGYEPRIIFLLLALALLLGFWFNVPR
FVLLAVVACAAVWVIAPFILVGDSHPLEDPLRRGAIIAFIAFITILYGVWRFMRALALNPALLDNFINPK
KDQSELEPDLSEINAVIRNGINYVRRIHSGIPTWKRFFVSSRWRSELPWFMVLGTKSAGKTSLILSSGQD
FPLPEQLDRIGKENVPTQHCECLFSNDALFLDTAGKYIDDGKEHQIEWNGILKALKKYRPVKAVNGVIVA
ISVTDILGKSKAELLTLSATLRARLDDVRGALGVRFPVYVTITKLDQLSGFDEYFRNLTAEDREQIWGVT
FPYNEDKGRADMELEQRISTELALLENRISNNMHVRQQEEYSVTDRKGMYALPQDFRLLSQRVTEVLQNV
FFASRFDETKFHTTLRGIYFVSSCQPANIGLLNNSTLVQKWRNVIRHMKPASPASLSQRSDDEGQLISET
AYGKQYFLKQLFRDVITQDGDLVSYNLKVQSKYRFQNLLGHVACIGLAVWLVWAFLISFQHNDGYLQAIG
TKLQHLESSVSRYVKTTNEQMLPMLLNATQQLPEYGTLDVENPSLDWRYGLYTGGAVSRGANNLYQFFLQ
KYLFPMVEREAEVSLKNAINSGDSEAVYVALKLYLMLTDEEHFDQSYVVDKVTQAWQKSGKIEPYEEKGI
FAFHLNTLFTQKAWRQYGQAADSELIKQARAMLAEKTETARLWGRVQSHLQAQAPANLTLRKMVGENATQ
VFTLSDAELLHEGVPGLYTHAGYHQVVKKKLTPLLMQLQQEDRWVMAQPLTSSFDPLALQQDVLTLYLKE
YTDYWKRFLSSVRLISVDADSGEYAEGLSLDIALLRTLVSENSPLLNLAKQSVKETTLVETVKEKTLLDD
ITIRNQGNLVNQAKKVQEKIAFRENKLVQEFVDSQFDGLRAFVKGEPSDGENNSNLSMIQGTQMSRVIGA
LNDQYTRLVVFNSAFEYGDIPPISHGGERIAIESQTWPDPLSNIIAPLLTSSSQKFENKVITHTSKAIDM
GIGEICRNTIQGRYPFADSEKVVSLSDFERFFGAGGTVDSYFKKNLESKVDTTTTPWRYKGSASRDGLEF
FEQAAVIRNALFNASEGRKVALDFSVSVRYLAPSITQLIMNFDGNIVRYSHGPVTPSFFKWPGVRQGTIV
SLTAQRQQASAMPDILLRGPWALLKWADKADEVAQDASGMQLLTYVMGKDRVELEVSGLTYGNESISELL
RGFQCPSALNDDMHEIW
 
Nucleotide Sequence: 3834 bp     [Download]
>gi|386307442|ref|NC_017564.1|:c1567912-1564079 Yersinia enterocolitica subsp. palearctica Y11, complete genome
ATGTCTTATTTGAATCGATTGTTTTCTGGCTGGGCCATGAAACGAATATTGCTGGTGGGCTGCTTTCTAT
TACTGGCTGCCGCAATATGGTTTTTGGGGCCTTTCCTCGGATTTGGCGAGACGCGGCCGCTTGAAGGTTA
CGAACCCAGAATTATTTTCTTACTGCTGGCTCTGGCTCTGTTATTGGGCTTTTGGTTTAACGTGCCGCGC
TTTGTTCTGTTGGCGGTGGTCGCCTGCGCTGCGGTATGGGTTATCGCGCCCTTTATATTAGTAGGGGATA
GCCATCCGCTGGAAGATCCATTGCGTCGTGGCGCAATCATCGCTTTTATTGCCTTTATCACCATTCTTTA
TGGTGTGTGGCGTTTTATGCGGGCTTTAGCGCTCAACCCTGCGCTATTGGATAATTTTATCAACCCGAAG
AAAGATCAATCTGAACTTGAACCTGACCTTTCTGAAATCAATGCGGTGATTCGCAATGGCATAAATTATG
TCCGTCGTATTCACAGTGGCATTCCAACCTGGAAGCGTTTTTTTGTTTCCAGCCGCTGGCGTAGCGAACT
GCCTTGGTTCATGGTGCTGGGCACCAAGAGTGCGGGTAAAACCTCACTGATCCTCTCATCAGGACAAGAT
TTCCCTCTGCCTGAGCAGTTGGATCGCATCGGTAAAGAAAATGTACCGACTCAGCATTGCGAATGTCTGT
TCTCTAATGATGCCCTGTTTTTAGATACCGCCGGTAAGTACATTGATGACGGCAAAGAGCATCAAATTGA
ATGGAATGGCATCTTAAAGGCGCTGAAAAAGTATCGTCCGGTCAAGGCGGTTAACGGCGTTATTGTGGCT
ATTTCAGTCACCGATATTTTGGGTAAAAGTAAAGCCGAGTTATTGACGCTATCGGCCACGCTGCGCGCGC
GTTTAGATGATGTTCGTGGTGCGCTCGGTGTTCGTTTCCCGGTATATGTGACTATCACCAAACTGGATCA
ACTGTCTGGTTTTGATGAGTATTTCCGCAATTTAACCGCCGAAGACCGCGAACAAATCTGGGGTGTGACT
TTCCCTTATAACGAGGACAAAGGGCGCGCGGATATGGAGCTTGAGCAGCGTATCAGCACTGAGTTGGCAC
TGCTTGAAAACCGCATCAGCAACAACATGCATGTGCGTCAGCAAGAAGAGTATTCCGTCACTGATCGTAA
AGGCATGTATGCGTTACCGCAGGATTTCAGATTGTTGTCCCAACGGGTGACTGAAGTCTTGCAGAATGTG
TTTTTTGCCTCGCGTTTTGATGAGACAAAGTTCCATACCACGTTGCGTGGGATCTATTTTGTTAGCAGTT
GCCAGCCTGCGAATATTGGGCTGTTAAATAACAGCACCCTGGTCCAGAAATGGCGCAATGTTATTCGTCA
TATGAAGCCTGCATCTCCGGCCTCGCTTTCGCAAAGAAGTGATGATGAAGGTCAACTGATCAGCGAAACG
GCTTATGGAAAACAATATTTCCTCAAGCAGCTATTCCGCGACGTCATCACCCAAGATGGGGATTTGGTGA
GCTATAACCTCAAAGTGCAATCCAAATACCGTTTCCAGAATTTATTGGGACACGTGGCTTGTATCGGGCT
GGCGGTGTGGCTGGTATGGGCATTCCTTATCAGTTTCCAGCACAACGATGGCTATTTACAGGCGATTGGT
ACCAAGCTCCAGCACTTAGAGAGCAGCGTTAGCCGTTATGTTAAAACCACCAATGAGCAGATGTTACCCA
TGCTGTTGAATGCCACTCAGCAGTTACCTGAGTACGGCACGCTGGATGTGGAAAACCCGAGTCTTGATTG
GCGTTATGGTTTATACACTGGCGGGGCGGTGTCTCGCGGCGCGAACAATTTGTATCAGTTTTTCCTGCAA
AAATACCTCTTCCCGATGGTTGAACGTGAGGCCGAAGTCTCATTAAAAAATGCGATCAATAGTGGTGATT
CTGAAGCGGTCTATGTCGCGTTAAAACTTTATCTCATGCTGACTGATGAAGAGCATTTCGATCAGAGTTA
TGTGGTCGATAAAGTCACTCAAGCTTGGCAGAAGAGCGGGAAAATCGAGCCTTATGAGGAGAAAGGTATT
TTCGCCTTCCATTTGAATACGCTTTTCACCCAAAAAGCGTGGCGACAATATGGACAAGCGGCAGATAGCG
AGCTTATCAAACAGGCCAGGGCCATGCTGGCAGAGAAAACTGAGACTGCCAGACTGTGGGGGCGCGTTCA
ATCACATTTACAGGCACAAGCGCCCGCCAATCTGACATTACGTAAAATGGTGGGTGAGAATGCGACACAG
GTTTTTACCCTATCGGATGCCGAATTACTGCATGAAGGGGTTCCGGGGTTATATACCCACGCCGGGTATC
ATCAGGTGGTTAAAAAAAAGCTTACGCCATTGCTGATGCAACTTCAGCAAGAGGATCGTTGGGTGATGGC
TCAGCCATTGACTTCTTCATTTGATCCTCTGGCGCTACAGCAAGATGTGCTAACCCTGTACTTGAAAGAA
TACACCGATTACTGGAAACGCTTCCTCTCCAGTGTGCGCCTGATTTCTGTTGATGCTGACAGTGGAGAGT
ATGCAGAAGGGTTATCTCTGGATATTGCGCTGTTGAGAACGCTGGTGTCAGAGAACTCACCTTTGCTCAA
TTTGGCAAAGCAGTCAGTGAAAGAAACGACGTTAGTTGAAACCGTAAAAGAGAAAACACTACTCGACGAT
ATAACAATAAGAAATCAGGGAAATTTAGTTAACCAGGCTAAAAAAGTGCAGGAAAAGATAGCTTTTCGTG
AGAATAAGCTGGTTCAGGAATTTGTTGATAGCCAATTTGACGGACTGCGCGCTTTTGTTAAGGGCGAACC
GAGCGATGGGGAGAATAACAGTAACCTTTCTATGATTCAGGGCACCCAGATGAGCCGGGTTATTGGTGCG
TTGAACGATCAATATACCCGTTTGGTGGTGTTTAACAGCGCGTTTGAATATGGCGATATCCCTCCGATCT
CTCACGGTGGGGAGCGTATCGCGATTGAGTCACAAACCTGGCCGGATCCGCTTAGCAATATCATTGCGCC
ACTTTTAACCAGTTCATCGCAGAAGTTTGAAAATAAAGTGATTACCCACACGTCGAAGGCCATCGATATG
GGGATCGGTGAGATATGCCGCAATACCATACAGGGGCGTTATCCCTTTGCTGATAGTGAGAAAGTCGTCA
GTTTGAGTGATTTTGAGCGCTTCTTCGGCGCGGGTGGCACGGTGGACAGTTACTTTAAGAAGAACCTGGA
AAGCAAAGTCGACACTACCACCACGCCTTGGCGTTATAAAGGCAGCGCAAGCCGTGATGGTCTGGAATTT
TTTGAACAGGCGGCGGTGATTCGCAATGCATTATTTAATGCCAGTGAAGGCCGCAAAGTGGCTTTAGACT
TCTCGGTATCCGTGCGTTATTTAGCCCCCTCAATTACGCAATTAATCATGAATTTTGACGGGAATATTGT
GCGCTATTCCCACGGCCCGGTGACGCCATCATTCTTCAAATGGCCGGGAGTTCGTCAAGGAACAATAGTG
AGTTTAACTGCTCAGCGCCAACAAGCTTCCGCGATGCCAGACATCCTGCTGCGTGGCCCTTGGGCATTGC
TGAAATGGGCTGATAAGGCTGATGAAGTGGCACAAGACGCCAGTGGCATGCAACTTCTGACCTATGTCAT
GGGCAAAGATCGCGTCGAGCTGGAAGTGTCCGGTTTGACTTACGGTAATGAGAGTATCAGTGAACTGCTT
AGAGGTTTCCAATGCCCAAGTGCGCTCAATGATGATATGCATGAAATTTGGTGA
 Primer design