SecReT6
Protein ID: 386324503
SecReT6 ID619
T6SS typei5
Gene symbol-
Locus tagSbal175_2046
StrainShewanella baltica BA175
Repliconchromosome [GenBank: NC_017571] [Browse all T6SS(s) in this replicon]
Location [Strand]2419888..2423424 [+]
Producttype VI secretion protein IcmF
NoteTssM
UniProt IDG0AY88
KEGG IDsbb:Sbal175_2046
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 6.90E-94, Aligned region: 196..458
ImcF-related_N [PF14331], Evalue: 6.90E-94, Aligned region: 477..512
ImcF-related_N [PF14331], Evalue: 6.90E-94, Aligned region: 1121..1136
IcmF-related [PF06761], Evalue: 2.10E-79, Aligned region: 506..807
DUF1215 [PF06744], Evalue: 9.60E-36, Aligned region: 917..1037
Protein Sequence: 1178 a.a.     [Download]
>gi|386324503|ref|YP_006020620.1| type VI secretion protein IcmF [Shewanella baltica BA175]
MNFKAILSMLLRVIKSSLFITVLGLLALALLIWFGGPLVAIAGVEPLATTSARLITLLSIALIWMISQFI
KRSRELKNHNQAVESLLSSDEQQHDELAKRDIEILTSRMQKAIDILKNARFSRARDIYQLPWYMLIGAPG
SGKTTTLQNSGLEFPLMEQLGIDPISGVGGTRQCDWWFTNEAVLIDTAGRYTTQDSHASQDSAAWQGFLG
LLRKYRPRRPINGVLVFVSLSDLINQTKTERNIHARAIKQRVQELQSQLGMTFPVYVIFTKADLVAGFTE
FFADLSAEEREQVWGVTFSADQTWDETGAVSQFNKEFHALINRLYQRLFTCLQHERDLESRSAIYEFPRQ
LRLLQSAADDFLKEIFSQNPFEKSTMLRGVYITSATQQGIPIDRIMQQVGGSSGLAEPPLRQQKGEGKGY
FIHRFFENILIPERDLATVNLRHKTKNTWLRHGVTALTMIATTWILYAWYDSYRWNQQLIENAAQSIEHY
KAASKSNTDLLALNNQLSILRDMPAGYAGVLPDGELKSIGLYQGDKLGQSAKIIYSKALYSSLLPELVNG
LTSEMRTNSTHRDYLYETLKTYLMLYHPEKFKSEQITAWYDAYLQRHLPGELNSDTRSSLLSHLNALIVN
GVQLQNYNDKIVAETRDILLTMPLSDLAYQKVKNELMKNNIPDFKLSDVLGMESANVIVRKSGASLKQGI
PGLYIYQGFHGVFNIEKRRIIKALLADNWIYGDIKAEENEEVEKVLSAQVTEKYLRDYTNYWKELLADLD
IQKIDDLEQGLYVTKVLAGPEQPIQSLIKAFQQNTKLSSLPESANVDMTLDVAGKVADTKFSSQKSRIGR
LLPDELPDFGKQLPGHEVELAFAPLLAINSAQMEQIAQTSQQYYAYLERLYAPSGGMAMQAFANQRENNA
GELSVMLRRLRSDVPSPFSDWLGNISTDTSKLFAKGSRQHINDAWKSNVVSEYQKAIHGRYPLDRNSSVD
IKIRDFERFFGYGGVLEQFFIDYLSPFVNTNLEQWRFKQNIGVSDRVLKTFQTAQNIRTMYFEPGSQKLK
IGFRLKPIYLDKHITHLLVELDGQELSYRHGPTRMTQFFWPGDRSRLQTRLVFTPANSGLLSSNTFKGEW
SWFRLLDELVKERPETKDDGILYLSVQGNKARVELVPDSVDNPFLSGTLEAFKCPNNL
 
Nucleotide Sequence: 3537 bp     [Download]
>gi|386322495|ref|NC_017571.1|:2419888-2423424 Shewanella baltica BA175 chromosome, complete genome
ATGAACTTCAAAGCAATACTTAGCATGTTACTGAGAGTAATAAAGTCGTCATTATTTATTACAGTACTCG
GTTTACTCGCTTTAGCATTACTGATTTGGTTTGGTGGACCACTCGTTGCGATTGCAGGTGTAGAACCCCT
TGCAACGACGAGTGCACGACTGATCACATTATTATCAATCGCTCTGATTTGGATGATATCTCAATTCATC
AAACGCAGCCGTGAGTTAAAAAACCATAATCAAGCTGTAGAATCTCTATTAAGTAGTGATGAACAGCAAC
ATGACGAATTAGCAAAACGCGATATCGAAATACTCACTTCGCGGATGCAAAAAGCTATTGATATATTGAA
GAATGCACGCTTTAGCCGTGCAAGGGACATATACCAATTACCTTGGTATATGCTCATTGGCGCCCCAGGT
TCAGGTAAAACGACCACATTACAAAATTCAGGTCTAGAGTTTCCGCTGATGGAGCAGTTAGGCATTGATC
CTATCAGTGGGGTAGGTGGTACACGTCAATGTGACTGGTGGTTCACAAATGAAGCCGTCTTAATCGACAC
TGCGGGTCGATATACAACGCAAGATAGTCATGCGTCACAGGACTCAGCTGCATGGCAAGGATTTTTAGGT
TTATTACGAAAATATCGACCTCGTAGACCAATCAATGGTGTGCTCGTATTTGTTAGTTTGTCAGATCTGA
TTAATCAGACTAAAACCGAGCGTAATATTCATGCTAGAGCGATTAAGCAGCGAGTACAGGAGCTTCAAAG
CCAACTAGGCATGACCTTTCCTGTGTACGTTATTTTTACAAAAGCCGATTTAGTCGCGGGTTTTACAGAG
TTTTTTGCAGATTTAAGTGCGGAAGAAAGAGAGCAAGTTTGGGGCGTGACATTCTCTGCAGACCAAACAT
GGGATGAAACGGGTGCCGTATCTCAGTTTAATAAAGAGTTCCACGCGCTGATTAATCGTTTATATCAACG
ATTGTTTACTTGTTTACAGCATGAAAGAGATCTTGAAAGTCGAAGTGCTATATATGAATTTCCTCGCCAG
CTTCGTTTGTTGCAGAGTGCCGCGGATGATTTTCTCAAAGAAATTTTTTCACAAAACCCTTTTGAAAAAT
CAACAATGTTACGCGGGGTATATATTACAAGTGCAACGCAACAAGGTATTCCTATCGATAGGATAATGCA
GCAAGTTGGAGGAAGCAGTGGTTTAGCTGAACCGCCATTAAGGCAGCAAAAAGGTGAAGGTAAAGGATAT
TTTATCCACCGTTTCTTTGAAAATATTCTTATCCCTGAGCGTGATCTTGCGACTGTAAATCTTCGCCACA
AAACTAAGAATACATGGCTACGTCACGGTGTTACGGCGCTAACCATGATCGCCACGACATGGATTTTATA
TGCTTGGTACGACAGCTATCGCTGGAATCAGCAATTGATTGAAAATGCTGCCCAATCAATTGAACATTAC
AAAGCTGCTTCTAAATCAAACACTGATCTATTAGCATTAAATAATCAATTAAGTATTCTACGTGATATGC
CTGCAGGATATGCTGGCGTTTTACCTGATGGAGAACTGAAAAGTATTGGCTTATATCAAGGCGATAAATT
AGGGCAGTCAGCGAAGATTATTTATAGTAAAGCATTATATTCAAGCTTACTACCTGAGCTCGTTAATGGC
TTGACCAGTGAAATGAGAACGAATAGCACTCATCGAGATTATTTGTATGAGACATTAAAAACATATTTAA
TGCTTTATCACCCTGAAAAGTTTAAGAGTGAACAAATTACTGCATGGTATGATGCATATTTACAGAGACA
TTTGCCTGGTGAGCTTAACTCAGATACAAGAAGTTCATTGCTATCTCATTTAAATGCATTAATTGTTAAT
GGAGTACAGCTCCAGAATTATAATGATAAAATAGTCGCTGAAACTCGAGATATATTGCTTACTATGCCTT
TATCAGATCTGGCATATCAAAAAGTTAAGAATGAGTTAATGAAAAATAACATTCCGGACTTCAAATTATC
AGATGTGTTGGGGATGGAAAGCGCAAATGTTATTGTTCGAAAAAGTGGCGCATCATTAAAACAAGGGATC
CCTGGGCTTTATATATATCAAGGTTTTCATGGGGTATTCAACATTGAGAAGCGAAGGATAATAAAAGCAT
TATTAGCCGATAACTGGATATATGGTGACATTAAAGCTGAAGAAAATGAAGAAGTAGAGAAAGTATTGTC
AGCGCAAGTTACGGAAAAGTATTTGCGTGATTATACAAACTACTGGAAAGAGTTACTTGCAGATTTAGAT
ATACAGAAAATTGACGATTTAGAACAAGGTCTTTATGTGACTAAAGTCCTCGCCGGACCTGAGCAGCCTA
TCCAAAGTTTGATTAAGGCTTTCCAACAAAACACAAAATTATCGTCGTTGCCCGAGTCTGCAAACGTCGA
TATGACGCTTGATGTTGCAGGAAAGGTAGCTGATACAAAGTTTTCATCACAAAAATCAAGGATTGGACGT
TTGCTTCCTGACGAACTTCCTGATTTTGGTAAACAGCTACCAGGACATGAAGTTGAGTTAGCATTTGCAC
CTCTTCTGGCGATTAATAGCGCGCAAATGGAACAAATTGCACAAACGAGTCAGCAATATTATGCGTACTT
AGAGCGGTTATATGCACCTAGCGGTGGTATGGCAATGCAGGCATTTGCAAATCAAAGAGAAAATAATGCA
GGCGAACTAAGCGTTATGCTACGTCGATTGCGTAGTGATGTGCCATCTCCTTTTTCTGATTGGCTTGGTA
ATATCTCTACAGACACATCAAAACTATTTGCTAAAGGTAGTCGACAACACATCAACGATGCTTGGAAAAG
TAATGTTGTTTCAGAATATCAAAAAGCGATTCATGGACGTTATCCTCTTGATAGGAATAGTTCAGTTGAT
ATTAAGATCCGAGATTTCGAACGTTTCTTCGGATATGGAGGCGTATTAGAGCAATTTTTCATTGATTATT
TGAGCCCATTTGTTAATACAAACCTCGAACAATGGCGCTTTAAGCAGAATATTGGTGTGAGTGATAGAGT
GTTAAAAACTTTTCAAACGGCACAAAATATTCGAACAATGTATTTCGAGCCTGGTTCTCAAAAGTTAAAA
ATTGGTTTTAGATTAAAGCCAATTTACTTAGATAAACATATTACTCACTTACTCGTTGAACTCGATGGGC
AAGAGTTATCTTACAGGCATGGACCAACGCGTATGACGCAGTTTTTTTGGCCCGGCGATAGAAGTCGATT
ACAGACTAGACTCGTTTTTACTCCGGCAAACTCAGGTTTACTTTCAAGTAATACCTTTAAAGGTGAGTGG
TCATGGTTCCGATTATTGGATGAACTGGTGAAGGAGCGTCCTGAAACTAAAGACGATGGGATTCTTTACT
TATCTGTCCAAGGAAACAAGGCTAGAGTCGAACTTGTGCCAGATAGTGTCGATAATCCATTTTTAAGTGG
TACATTGGAGGCATTTAAATGTCCGAACAACCTTTGA
 Primer design