SecReT6
Protein ID: 386336068
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01065
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1199515..1200198 [-]
Producthypothetical protein
NoteTssI
UniProt IDF6G9B4
KEGG IDrsn:RSPO_m01065
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-40, Aligned region: 46..215
Protein Sequence: 227 a.a.     [Download]
>gi|386336068|ref|YP_006032238.1| hypothetical protein RSPO_m01065 [Ralstonia solanacearum Po82]
MKSLPSPPAAVPQAVLGALLGQQTRQITLQTALASDNLVVERFTAREAVSTPFVLEVDCLSSSAHIDPAK
LASREATLRLMLADGRRRAWHGYVADCTALGGDGGLARYRLRIVPWLDRLNGREDCFVYQDKTALEIIED
LFADYPIAQYKLAVSQPCAKRSICCQYRETDYAFMLRLLAEEGLSFRIEHEQGDAPRDGSAQSRHSVVIF
GNDDAPCAFLEHSNALG
 
Nucleotide Sequence: 684 bp     [Download]
>gi|386335008|ref|NC_017575.1|:c1200198-1199515 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGAAGTCACTGCCTTCCCCGCCGGCCGCCGTGCCGCAAGCCGTCCTGGGCGCGCTGCTCGGGCAGCAGA
CCCGCCAGATCACACTGCAGACGGCGCTGGCCTCCGACAACCTGGTGGTGGAGCGCTTCACGGCGCGCGA
AGCGGTCTCGACGCCGTTCGTGCTGGAGGTGGATTGCCTGAGCTCCTCGGCTCACATCGACCCGGCCAAG
CTGGCCTCGCGTGAGGCCACGCTGCGCCTGATGCTCGCCGACGGACGGCGCCGCGCCTGGCACGGCTACG
TGGCCGATTGCACGGCCCTCGGCGGCGACGGCGGGCTGGCGCGCTACCGGCTGCGCATCGTGCCCTGGCT
CGACCGCCTCAACGGCCGCGAAGACTGCTTCGTCTACCAGGACAAGACCGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCATCGCGCAGTACAAGCTCGCCGTCAGCCAGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTATCGCGAGACCGACTACGCCTTCATGCTGCGCCTGCTGGCCGAAGAGGGCCTGTCGTTCCG
CATCGAGCACGAGCAGGGCGACGCGCCGCGCGACGGCAGCGCGCAGTCGCGCCACAGCGTCGTCATCTTC
GGCAATGACGACGCCCCTTGCGCTTTCCTCGAGCATTCGAACGCGCTTGGCTGA
 Primer design