SecReT6
Protein ID: 386336068
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01065
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1199515..1200198 [-]
Producthypothetical protein
NoteTssI
UniProt IDF6G9B4
KEGG IDrsn:RSPO_m01065
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-40, Aligned region: 46..215
Protein Sequence: 227 a.a.     [Download]
>gi|386336068|ref|YP_006032238.1| hypothetical protein RSPO_m01065 [Ralstonia solanacearum Po82]
MKSLPSPPAAVPQAVLGALLGQQTRQITLQTALASDNLVVERFTAREAVSTPFVLEVDCLSSSAHIDPAK
LASREATLRLMLADGRRRAWHGYVADCTALGGDGGLARYRLRIVPWLDRLNGREDCFVYQDKTALEIIED
LFADYPIAQYKLAVSQPCAKRSICCQYRETDYAFMLRLLAEEGLSFRIEHEQGDAPRDGSAQSRHSVVIF
GNDDAPCAFLEHSNALG
 
Nucleotide Sequence: 684 bp     [Download]
>gi|386335008|ref|NC_017575.1|:c1200198-1199515 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGAAGTCACTGCCTTCCCCGCCGGCCGCCGTGCCGCAAGCCGTCCTGGGCGCGCTGCTCGGGCAGCAGA
CCCGCCAGATCACACTGCAGACGGCGCTGGCCTCCGACAACCTGGTGGTGGAGCGCTTCACGGCGCGCGA
AGCGGTCTCGACGCCGTTCGTGCTGGAGGTGGATTGCCTGAGCTCCTCGGCTCACATCGACCCGGCCAAG
CTGGCCTCGCGTGAGGCCACGCTGCGCCTGATGCTCGCCGACGGACGGCGCCGCGCCTGGCACGGCTACG
TGGCCGATTGCACGGCCCTCGGCGGCGACGGCGGGCTGGCGCGCTACCGGCTGCGCATCGTGCCCTGGCT
CGACCGCCTCAACGGCCGCGAAGACTGCTTCGTCTACCAGGACAAGACCGCGCTGGAGATCATCGAAGAC
CTCTTCGCCGATTACCCCATCGCGCAGTACAAGCTCGCCGTCAGCCAGCCGTGCGCCAAGCGCTCGATCT
GCTGCCAGTATCGCGAGACCGACTACGCCTTCATGCTGCGCCTGCTGGCCGAAGAGGGCCTGTCGTTCCG
CATCGAGCACGAGCAGGGCGACGCGCCGCGCGACGGCAGCGCGCAGTCGCGCCACAGCGTCGTCATCTTC
GGCAATGACGACGCCCCTTGCGCTTTCCTCGAGCATTCGAACGCGCTTGGCTGA
 Primer design

Protein ID: 386336080
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01077
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1212977..1213861 [+]
ProductVgrG protein
NoteTssI
UniProt IDF6G9C6
KEGG IDrsn:RSPO_m01077
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-42, Aligned region: 42..263
Protein Sequence: 294 a.a.     [Download]
>gi|386336080|ref|YP_006032250.1| VgrG protein [Ralstonia solanacearum Po82]
MVPPTELANLLRSAFTQADRLLRLETPLGPNALLPERLDAAEHLDEGGFRLELTALSDDADLDPARLLGQ
PVRLDLLTQLSRSTLRPFHGHVTRFEQLGANGGLVRYRLVVEPWLAFLRHRRDSFLFQDMSVIEVIDSLF
GDYNGQGRLTPAWRWSLHDTSVYTRRSVITQYEESDFDFASRLLAEEGLFYFFEHEVVQGRGAGRAPHGD
RRCQRRVRRQRAGCHPLRSRRCHRQRRRDRPLAGRTALADQRRVGRQLGLPRQRQAQRPARRAAARRRSA
VDAAGHRLPRPVRV
 
Nucleotide Sequence: 885 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1212977-1213861 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGTCCCACCGACCGAGCTGGCCAACCTGCTGCGGTCGGCCTTCACCCAGGCGGACCGGCTGTTGCGCC
TGGAAACGCCGCTCGGGCCGAACGCGCTGCTGCCCGAGCGGCTGGACGCCGCCGAGCACCTGGACGAGGG
CGGTTTCCGGCTGGAGCTGACGGCGCTGTCCGACGACGCCGATCTCGACCCGGCGCGCTTGCTGGGGCAG
CCCGTCCGGCTCGATTTGCTGACCCAACTGAGCCGCAGCACGCTGCGGCCGTTCCATGGCCACGTCACGC
GGTTCGAGCAGTTGGGCGCCAACGGCGGGCTGGTGCGCTACCGATTGGTGGTCGAGCCGTGGCTGGCCTT
CCTGCGCCACCGGCGCGACAGTTTCCTGTTCCAGGACATGTCGGTCATCGAGGTGATTGACAGCCTGTTC
GGCGACTACAACGGCCAGGGTCGCCTGACGCCGGCGTGGCGCTGGTCGTTGCACGATACCTCGGTGTACA
CGCGCCGCAGCGTCATCACGCAATACGAAGAAAGCGATTTCGATTTCGCCTCCCGCCTGCTGGCCGAGGA
AGGGCTGTTCTATTTCTTCGAGCACGAGGTGGTGCAGGGGCGAGGCGCTGGGCGTGCACCGCATGGTGAT
CGCCGATGCCAACGACGTGTTCGTCGACAACGCGCAGGCTGCCATCCGCTTCGGTCGCGCCGATGCCACC
GCCAGCGAAGACGTGATCGACCGCTGGCAGGGCGTACGGCGCTGGCAGACCAACGCCGTGTCGGTCGCCA
GCTGGGACTACCGCGCCAACGCCAAGCGCAGCGCCCAGCTCGGCGCGCAGCAGCGCGGCGGCGGTCCGCA
GTTGACGCTGCAGGACACCGATTACCCCGGCCAGTACGGGTTTGA
 Primer design

Protein ID: 386336081
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01078
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1213599..1214219 [+]
Productvgr-related protein
NoteTssI
UniProt IDF6G9C7
KEGG IDrsn:RSPO_m01078
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-23, Aligned region: 1..154
Protein Sequence: 206 a.a.     [Download]
>gi|386336081|ref|YP_006032251.1| vgr-related protein, partial [Ralstonia solanacearum Po82]
MVIADANDVFVDNAQAAIRFGRADATASEDVIDRWQGVRRWQTNAVSVASWDYRANAKRSAQLGAQQRGG
GPQLTLQDTDYPGQYGFEDNAQAQHSARIVMEALELRGRQFDGEGSARTLAPGTCFQLADHYGQDGAGED
RFAVLSVAHRVRNNFNERFGQVLARTLGALAGLDALGGAGNAGTDGDATFYRNHFTVVRDSVPPAA
 
Nucleotide Sequence: 621 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1213599-1214219 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGTGATCGCCGATGCCAACGACGTGTTCGTCGACAACGCGCAGGCTGCCATCCGCTTCGGTCGCGCCG
ATGCCACCGCCAGCGAAGACGTGATCGACCGCTGGCAGGGCGTACGGCGCTGGCAGACCAACGCCGTGTC
GGTCGCCAGCTGGGACTACCGCGCCAACGCCAAGCGCAGCGCCCAGCTCGGCGCGCAGCAGCGCGGCGGC
GGTCCGCAGTTGACGCTGCAGGACACCGATTACCCCGGCCAGTACGGGTTTGAAGACAACGCCCAGGCCC
AGCACAGCGCGCGCATCGTGATGGAAGCGCTGGAGCTGCGCGGCCGGCAGTTCGACGGCGAAGGCAGCGC
GCGCACGCTGGCGCCCGGCACGTGCTTCCAGTTGGCTGACCACTACGGCCAGGATGGCGCGGGGGAGGAC
CGCTTCGCCGTGCTGTCCGTGGCGCATCGGGTGCGCAACAACTTCAACGAGCGCTTCGGGCAGGTGCTGG
CGCGGACGCTGGGGGCGCTGGCCGGGCTCGATGCGCTGGGCGGTGCGGGCAACGCCGGCACCGACGGCGA
CGCCACGTTCTATCGGAACCACTTCACGGTCGTGCGCGACAGCGTGCCGCCCGCAGCGTAG
 Primer design

Protein ID: 386336095
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01093
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1230234..1233446 [+]
Productvgr-related protein
NoteTssI
UniProt IDF6G9E1
KEGG IDrsn:RSPO_m01093
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 5.60E-55, Aligned region: 37..354
Phage_GPD [PF05954], Evalue: 5.60E-55, Aligned region: 735..786
DUF2345 [PF10106], Evalue: 1.40E-39, Aligned region: 177..202
DUF2345 [PF10106], Evalue: 1.40E-39, Aligned region: 767..927
T6SS_Vgr [PF13296], Evalue: 1.80E-34, Aligned region: 167..192
T6SS_Vgr [PF13296], Evalue: 1.80E-34, Aligned region: 613..723
T6SS_Vgr [PF13296], Evalue: 1.80E-34, Aligned region: 824..861
T6SS_Vgr [PF13296], Evalue: 1.80E-34, Aligned region: 886..907
Phage_base_V [PF04717], Evalue: 6.40E-18, Aligned region: 450..548
Protein Sequence: 1070 a.a.     [Download]
>gi|386336095|ref|YP_006032265.1| vgr-related protein [Ralstonia solanacearum Po82]
MDVTILLQNLFAPARRLYALEGEGPITELAVEARLGREALSELSEWRVVAVSANARIVLDAFIGQRVTLV
TTLAGGTQARRTGLIRQAEQLGADGSLARYRLTVVPWSWLTTQQRHSQVFQNRPLADILEQVLSPYEPYA
SWRFAAGAEDRMAAFGTRRRLTQLRETDYHFATRLLAEAGLGFTTVEDDQALSGHTLLIFADSSRLAEDT
ESAAGGGIRYHRAHSQEERDAIQQLICHSRVSIDGVAVSAWDAEAKRSVRGHAPARFGGGMGCPDPYLSI
SPSLAPDRANAQRIAEQAMESVEARCGLFIGRGTVRTLRSGTRLKVVDCPHLPQDVHGPYPLLMDLVEHC
GINNLTADTQATLGQKLGGLEAALTFDTPPSPLESGPGPFGFTRQDEPTERLTPTGELRAAAHAHGYAGQ
FRACDARRPWRAVVSHASTSRLYSAPTVKGVHSAIVVGPDGQTEAGGDGEHHTNPRGQIRVRLPWQQGER
PDDRSTGWVPVAQRQAGAGMGWQWLPRIGQEVLLKCLEDDIDQMVVIGVLYNGQGEAGLAPTPGGRAAKG
QIQGDRESLYRLGSDSASSAQANLAGGQSPAWHGMGTDPEGHRNAAALSGFKSAEHGGRGYSQLVFDDSD
GQLRTQLATTQAYSQLNLGHLIHQQDNRRGSFRGQGFELRTDGYGAVRGQAGLLVTTYRDAVSGQAVPTG
DNAAGIALIKQAKQLTASLSQGAVTHQTAALSTAKDDTAPLAKQEKAALGMVDGKALDTAKQDAVSGNTT
TQGKVPHQGEAMAQLAGRAGLVAVAGQDLQFANGESLALASGQDTNVAVGKQARVHAGQGIGVAAGLSQA
GDGNIGLQLTAGQDDIDVQAQHDALNLLSEQGLKLVSANLNVDFAAAKRIRLATAEGASITLENGNITVE
CPGPITYKAAQRTFEGPVNQSYPLPAFPDQRIEDVPVHFNVNMQDVPGPSGAAISLADWRIVKADGEFAA
LYSEDARGYTVGNHAAQRNGPLDGRLGRQLARGDEGDAALGFTPGQDWRADFGAGWCRRSSAAVRQAAAR
GISRLRRQRRLVGFADSADH
 
Nucleotide Sequence: 3213 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1230234-1233446 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGACGTAACGATCCTTCTCCAGAACCTCTTCGCCCCCGCCCGCCGCCTGTACGCGCTGGAAGGCGAGG
GCCCGATCACGGAACTGGCAGTGGAAGCCCGGCTCGGCCGCGAGGCGCTGTCCGAGCTGTCCGAATGGCG
TGTGGTGGCGGTCAGCGCCAATGCCCGCATCGTGCTCGATGCGTTCATCGGCCAGCGCGTGACGCTGGTC
ACCACGCTGGCCGGCGGCACGCAGGCCCGGCGCACCGGCCTGATCCGCCAGGCCGAGCAGCTCGGCGCCG
ACGGCAGCCTCGCGCGCTATCGCCTCACCGTGGTGCCGTGGTCCTGGCTCACCACCCAGCAGCGCCACAG
CCAGGTGTTCCAGAACCGGCCGCTGGCGGACATCCTCGAGCAGGTGCTGTCGCCGTATGAGCCCTATGCT
TCGTGGCGCTTCGCCGCAGGCGCCGAAGACCGCATGGCCGCGTTCGGCACGCGCCGCCGCCTCACCCAGC
TCCGCGAGACCGACTATCACTTCGCCACCCGCCTGCTGGCCGAGGCCGGCCTGGGCTTCACCACCGTCGA
GGACGACCAGGCCCTCAGCGGCCACACGCTGCTGATCTTCGCCGACAGCAGTCGGCTGGCCGAGGATACC
GAGTCCGCCGCCGGCGGCGGCATCCGCTACCACCGCGCGCACAGCCAGGAGGAACGCGACGCCATCCAGC
AGTTGATCTGCCACAGCCGGGTCAGCATCGACGGTGTAGCGGTATCGGCCTGGGACGCCGAGGCCAAGCG
CAGCGTGCGCGGCCATGCGCCGGCCCGCTTTGGTGGCGGCATGGGCTGCCCCGACCCCTATCTGTCGATC
AGCCCGTCGCTGGCGCCGGATCGGGCCAACGCCCAGCGCATCGCCGAGCAGGCGATGGAGAGCGTCGAAG
CGCGCTGCGGGTTGTTCATCGGACGCGGCACGGTGCGCACACTGCGCAGCGGCACGCGGCTGAAGGTGGT
CGACTGCCCGCACCTGCCACAGGACGTGCACGGCCCGTATCCGTTGCTGATGGACCTGGTGGAGCACTGC
GGCATCAACAACCTGACCGCCGATACCCAGGCCACACTGGGCCAGAAGCTGGGCGGGCTCGAAGCCGCAT
TGACGTTCGACACGCCGCCCAGCCCACTCGAATCCGGCCCCGGCCCGTTCGGCTTTACGCGGCAGGACGA
GCCCACCGAAAGGCTTACCCCTACCGGCGAACTCCGTGCCGCTGCCCATGCCCACGGCTACGCCGGCCAG
TTCCGCGCCTGCGATGCCCGCCGCCCCTGGCGTGCAGTGGTGTCGCATGCGTCCACGAGCCGCCTATATT
CGGCGCCCACCGTGAAGGGCGTGCACAGCGCCATCGTGGTCGGCCCGGACGGTCAGACCGAGGCGGGCGG
CGACGGCGAGCATCACACCAATCCACGAGGCCAGATCCGCGTGCGCCTGCCGTGGCAGCAGGGCGAGCGG
CCGGACGACCGCAGCACCGGCTGGGTGCCGGTCGCGCAACGGCAAGCTGGCGCCGGCATGGGCTGGCAAT
GGCTGCCGCGTATCGGCCAGGAGGTATTGTTGAAGTGCCTGGAAGACGATATCGATCAGATGGTGGTGAT
CGGCGTGCTCTATAACGGCCAGGGCGAAGCGGGCCTCGCGCCGACACCGGGCGGGCGAGCCGCGAAGGGC
CAAATCCAGGGCGATCGGGAGTCGCTCTACCGCTTGGGCAGTGACAGCGCGTCCAGTGCCCAGGCCAACC
TCGCCGGCGGCCAAAGCCCGGCGTGGCACGGCATGGGCACCGATCCCGAAGGCCACCGCAACGCTGCCGC
GCTGAGCGGCTTCAAGAGCGCCGAGCACGGCGGGCGCGGCTACAGCCAACTGGTCTTCGACGACAGCGAC
GGGCAACTGCGCACGCAACTGGCCACCACGCAGGCCTACAGCCAGCTCAACCTCGGCCACCTGATCCACC
AGCAGGACAACCGGCGCGGCAGCTTCCGGGGCCAGGGCTTCGAGCTGCGCACCGACGGCTACGGCGCCGT
GCGCGGGCAGGCCGGGCTGCTGGTCACTACCTACCGCGATGCGGTCAGCGGCCAGGCCGTACCGACCGGG
GACAACGCGGCTGGCATTGCCCTCATCAAGCAGGCCAAGCAGCTCACGGCATCCTTGAGCCAAGGCGCCG
TCACCCACCAGACGGCCGCGCTGTCCACCGCCAAGGACGACACCGCACCGCTGGCCAAGCAAGAAAAGGC
AGCTCTGGGCATGGTCGACGGCAAGGCGCTCGACACGGCCAAGCAGGATGCCGTCTCAGGCAACACCACG
ACGCAAGGCAAGGTGCCGCACCAGGGCGAGGCGATGGCGCAACTGGCCGGCCGTGCGGGCCTGGTGGCGG
TGGCCGGGCAGGACCTGCAGTTCGCCAACGGCGAGAGCCTCGCGCTGGCCAGCGGCCAAGACACCAACGT
GGCGGTGGGCAAGCAGGCACGTGTGCATGCGGGGCAGGGCATCGGCGTGGCGGCGGGGCTGTCCCAGGCG
GGCGACGGCAACATCGGGCTGCAGCTGACAGCGGGGCAGGACGACATCGACGTGCAGGCGCAGCATGACG
CGCTGAATCTGCTCTCCGAGCAGGGCCTGAAGCTGGTGTCGGCCAATCTGAACGTGGACTTCGCGGCGGC
CAAGCGGATCCGGCTGGCGACGGCGGAGGGGGCGTCGATCACGCTGGAGAACGGGAACATTACGGTCGAG
TGTCCGGGGCCGATTACGTATAAGGCGGCGCAGCGCACCTTTGAGGGGCCGGTGAATCAGTCGTATCCGT
TGCCGGCGTTTCCGGATCAACGGATCGAGGATGTGCCGGTTCACTTCAATGTCAACATGCAGGACGTTCC
GGGGCCTTCGGGGGCGGCCATATCGCTTGCCGACTGGCGCATCGTGAAAGCCGATGGCGAGTTTGCCGCG
CTGTACAGCGAGGATGCCCGCGGGTACACCGTCGGCAACCACGCTGCTCAACGCAACGGGCCGCTCGATG
GCAGGCTTGGTCGGCAACTCGCCAGAGGGGATGAAGGTGACGCAGCGCTTGGGTTCACGCCCGGTCAAGA
TTGGCGCGCTGACTTCGGAGCAGGGTGGTGTCGTCGTTCAAGCGCAGCGGTCCGGCAAGCCGCCGCGCGA
GGGATATCACGCCTACGCCGGCAACGCCGGCTGGTCGGGTTCGCAGATTCTGCCGACCATTGA
 Primer design