SecReT6
Protein ID: 386336069
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01066
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1200259..1201047 [-]
Producthypothetical protein
NoteTssL
UniProt IDF6G9B5
KEGG IDrsn:RSPO_m01066
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.10E-57, Aligned region: 32..233
Protein Sequence: 262 a.a.     [Download]
>gi|386336069|ref|YP_006032239.1| hypothetical protein RSPO_m01066 [Ralstonia solanacearum Po82]
MSATTTPSLFGGSAPAGNAAADAHDPNTHVRTLLDLLYDGFFMLFQLRNGQQPTSAEDFLARVRAFLEDF
DRGAKRLNVSAEDVFDAKYAFCAAVDETILSSNFAIRTAWERRPLQLELFGEQLAGETFFIKLEELRAHG
APRLQALEVFHMCLLLGFRGKYILEGPEKLAYLTARLGDEISAIKGKRAPFAPHWLLPDKVTHRLKRETP
LWIFGAVFALIALLGYIGLSSTLRSKTNETLEGYSQVVKLGPRFSHLTISLP
 
Nucleotide Sequence: 789 bp     [Download]
>gi|386335008|ref|NC_017575.1|:c1201047-1200259 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGAGCGCTACCACCACGCCCTCGCTGTTCGGCGGCTCCGCCCCTGCCGGCAACGCCGCTGCCGATGCGC
ACGACCCCAACACGCACGTGCGCACGCTGCTGGACCTGCTGTACGACGGCTTCTTCATGCTCTTCCAACT
GCGCAACGGCCAGCAGCCGACCAGCGCGGAAGACTTCCTCGCCCGCGTGCGGGCCTTCCTGGAAGACTTC
GACCGCGGGGCCAAGCGGCTGAACGTGTCGGCCGAAGACGTGTTCGACGCCAAGTACGCGTTCTGCGCCG
CCGTGGACGAGACCATCCTGTCGTCCAACTTCGCCATCCGTACCGCGTGGGAGCGCCGTCCGCTGCAGCT
GGAACTGTTCGGCGAGCAGCTCGCCGGCGAAACGTTCTTCATCAAGCTGGAAGAACTGCGCGCGCACGGA
GCGCCCCGCCTGCAGGCGCTGGAGGTGTTCCACATGTGCCTGCTGCTGGGCTTCCGCGGCAAGTACATCC
TCGAAGGGCCCGAGAAGCTGGCCTACCTGACCGCACGCCTGGGCGATGAGATTTCCGCCATCAAGGGCAA
GCGCGCGCCCTTCGCGCCGCATTGGCTGCTGCCGGACAAGGTGACGCACCGCCTCAAGCGCGAAACGCCG
CTGTGGATCTTCGGCGCGGTGTTCGCGCTGATCGCGCTGCTGGGGTACATCGGCCTGTCGTCCACGCTGC
GCTCGAAAACGAACGAGACGCTGGAGGGCTATTCGCAGGTCGTCAAGCTCGGGCCGCGCTTCTCGCACCT
GACCATCTCGCTGCCTTGA
 Primer design