SecReT6
Protein ID: 386336070
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01067
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1201044..1202390 [-]
Producthypothetical protein
NoteTssK
UniProt IDF6G9B6
KEGG IDrsn:RSPO_m01067
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.70E-133, Aligned region: 19..446
Protein Sequence: 448 a.a.     [Download]
>gi|386336070|ref|YP_006032240.1| hypothetical protein RSPO_m01067 [Ralstonia solanacearum Po82]
MSYSAKILWGEGLFLRPQHFQRQDAYHESRLHATAQMIQPYGWGIRHAQFDTDALASGVLRATGLSLFFP
DGELYFAPQADTLPPPLVLDAIPAGISELTFHLALYPLQDSGGNYRGQPEGGTVSRFVSTEAETADLFTE
AESASITYLKKSVKLVAESEPRDQFISLPVVRVRRTGTGGFELDDTFVAPSLSINASPVLYQRLRRLLDA
LQAKVNALYGFHREPTKNIIEFRSGDIASFWLLHTANAAFAALSHLYHHPDLHPERLFQEVLRLAGALMT
FTKTYTLADLPAYDHDDPGPVFSRLDTIVRELLDTVISTRYFAIALEETRPSFHLGRIDSGKIDDKTSFY
LSVSADMPVAELVEAIPARFKVGAPDDVDKLVLSSMPGVPLTYTPQVPPAIPVRPGACYFAVESRGMLYE
RMLQAQTITIYAPAGIRELKLELIAVTS
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|386335008|ref|NC_017575.1|:c1202390-1201044 Ralstonia solanacearum Po82 megaplasmid, complete sequence
GTGAGCTATTCCGCCAAAATCCTCTGGGGCGAAGGGCTGTTCCTGCGACCCCAGCACTTCCAGCGCCAGG
ACGCGTACCACGAATCCCGCCTGCATGCGACGGCGCAGATGATCCAGCCGTACGGATGGGGCATCCGCCA
CGCACAGTTCGACACCGACGCCCTCGCCAGCGGCGTGCTGCGCGCGACCGGGCTGTCGCTGTTCTTTCCG
GACGGCGAACTGTACTTCGCTCCGCAGGCCGATACCCTGCCGCCGCCGCTCGTGCTGGATGCGATCCCGG
CCGGCATCTCGGAGCTGACCTTCCACCTCGCGCTCTATCCGCTGCAGGACAGCGGCGGCAACTACCGCGG
GCAGCCGGAAGGCGGCACGGTGTCGCGCTTCGTCTCCACCGAGGCGGAGACCGCGGATCTGTTCACCGAA
GCCGAATCCGCGTCCATCACCTACCTCAAGAAGTCGGTGAAGCTGGTGGCGGAAAGCGAGCCGCGCGACC
AGTTCATCTCGCTGCCCGTCGTGCGGGTGCGTCGGACCGGCACCGGCGGTTTCGAGCTGGACGACACCTT
CGTCGCGCCGAGCCTGTCGATCAATGCGTCGCCCGTGCTGTACCAGCGCCTGCGCCGCCTGCTGGACGCC
CTGCAGGCCAAGGTCAACGCGCTGTATGGCTTTCACCGCGAGCCGACCAAGAACATCATCGAATTCCGCT
CGGGCGATATCGCATCGTTCTGGCTGCTGCACACGGCCAATGCCGCCTTCGCTGCGCTGTCGCATCTCTA
TCACCACCCGGACCTGCATCCGGAGCGGCTGTTCCAGGAGGTGCTGCGCCTGGCCGGCGCGCTGATGACA
TTCACCAAGACCTACACCCTCGCCGACCTGCCAGCCTACGACCACGACGACCCCGGTCCGGTGTTCTCCC
GGCTGGACACCATCGTGCGCGAACTGCTCGATACCGTGATCTCGACGCGCTACTTCGCGATCGCGCTGGA
GGAGACGCGGCCGTCGTTCCATCTCGGCCGGATCGACTCCGGCAAGATCGACGACAAGACCAGCTTCTAC
CTGTCGGTGTCGGCCGACATGCCGGTGGCGGAGCTGGTGGAGGCGATTCCCGCGCGCTTCAAGGTCGGTG
CGCCGGACGACGTGGACAAACTCGTGCTGTCGTCCATGCCGGGCGTGCCGCTCACCTATACGCCGCAGGT
GCCGCCCGCCATTCCGGTGCGTCCGGGCGCGTGCTACTTCGCGGTCGAATCGCGCGGCATGCTGTACGAG
CGCATGCTGCAGGCCCAGACCATCACCATCTATGCCCCGGCCGGCATCCGGGAACTCAAACTTGAACTCA
TCGCGGTGACTTCATGA
 Primer design