SecReT6
Protein ID: 386336073
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01070
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1204083..1204595 [+]
Producthypothetical protein
NoteTssB
UniProt IDF6G9B9
KEGG IDrsn:RSPO_m01070
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.10E-59, Aligned region: 11..163
Protein Sequence: 170 a.a.     [Download]
>gi|386336073|ref|YP_006032243.1| hypothetical protein RSPO_m01070 [Ralstonia solanacearum Po82]
MAKKESVQKRLQKVRPPRVQLTYDVEKGDAIEQKELPFVVGVVADLSGQSEVPQPKLRDRKFVNVDRDNF
DDVMSAVEPRAAFQVPNTLTEEGGRFGVDLKFRSLEDFAPEAVVNQIEPLRQLLEARSKLADLRNKLAGN
DKLEDLLSDVLNNTEALQKLGAKNAGGEDA
 
Nucleotide Sequence: 513 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1204083-1204595 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGCCAAGAAAGAAAGTGTGCAGAAGCGTTTGCAAAAGGTGCGCCCCCCGCGCGTGCAGCTGACGTACG
ACGTTGAGAAGGGCGACGCGATCGAGCAGAAGGAACTGCCGTTCGTGGTCGGCGTGGTGGCGGACCTGTC
GGGCCAGTCGGAAGTGCCGCAGCCCAAGCTGCGCGACCGCAAGTTCGTCAACGTCGATCGCGACAACTTC
GACGACGTGATGTCGGCGGTCGAGCCGCGCGCCGCCTTCCAGGTGCCGAACACGCTGACGGAAGAGGGCG
GCCGTTTCGGCGTCGATCTCAAGTTCCGTTCGCTGGAAGACTTCGCGCCGGAAGCCGTGGTGAACCAGAT
CGAGCCGCTGCGCCAACTGCTGGAAGCGCGCTCCAAGCTGGCCGACCTGCGCAACAAGCTGGCCGGCAAC
GACAAGCTCGAAGACCTGCTGTCCGACGTGCTGAACAACACCGAGGCACTGCAGAAACTGGGCGCCAAGA
ACGCTGGGGGCGAGGATGCTTGA
 Primer design