SecReT6
Protein ID: 386336074
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01071
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1204588..1206078 [+]
Producthypothetical protein
NoteTssC
UniProt IDF6G9C0
KEGG IDrsn:RSPO_m01071
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.00E-193, Aligned region: 68..491
Protein Sequence: 496 a.a.     [Download]
>gi|386336074|ref|YP_006032244.1| hypothetical protein RSPO_m01071 [Ralstonia solanacearum Po82]
MLDNQSAALAQSAPAAEAVNLLDQIVDQSRVAKSDAEHARAKDIIGELVNQVLQGTVVVSDNLSATLDAR
VAELDRLISSQLSAVMHAPEFQKLESTWRGLSYLVQETQTGTMIKIKVLNATKRDLVRDFKTAIDFDQSA
LFKKVYEEEFGTFGGAPFGTLIGDFDVTRQPEDVYFIEQMSHVAAAAHAPFIASSSPELFGLESFADLGK
PRDLAKVFDTVEYAKWKSFRESEDSRYVGLTMPRFLGRLPYNPKDGTTVEGFNFVEDVDGTDHSKYLWCN
AAWAFGARLTAAFEDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYDTDSANANAVLSAQLQYIFSVSRVAHYLKAMMRDKIGSFASAKNV
ETFLNRWISQYVLLDDNATQEQKAQFPLREASIQVSEVPGKPGTYRSVAFLRPHFQLDELSISLRLVADL
PKPTNS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1204588-1206078 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGCTTGACAACCAATCCGCCGCGCTCGCGCAGAGCGCACCGGCAGCCGAGGCCGTCAACCTGCTCGACC
AGATCGTCGACCAGAGCCGTGTCGCCAAGTCGGACGCCGAGCACGCACGCGCCAAGGACATCATCGGCGA
GCTGGTCAACCAGGTGCTGCAGGGCACGGTGGTGGTGTCCGACAACCTGTCGGCCACGCTGGATGCCCGC
GTGGCCGAGCTGGATCGCCTGATCTCGTCGCAGTTGAGCGCCGTCATGCATGCGCCCGAATTCCAGAAGC
TGGAAAGCACGTGGCGGGGCTTGTCGTACCTGGTCCAGGAAACGCAGACCGGCACGATGATCAAGATCAA
GGTGCTCAACGCCACCAAGCGAGACCTCGTGCGCGACTTCAAGACGGCCATCGATTTCGATCAGAGCGCG
CTGTTCAAGAAGGTGTACGAAGAGGAGTTCGGCACCTTCGGCGGCGCGCCGTTCGGCACGCTGATCGGCG
ATTTCGACGTCACGCGCCAGCCGGAAGACGTGTACTTCATCGAGCAGATGTCGCACGTGGCCGCGGCCGC
GCACGCGCCGTTCATCGCCTCGTCGTCGCCGGAGCTGTTCGGCCTGGAATCGTTTGCCGACCTGGGCAAG
CCGCGCGACCTGGCCAAGGTGTTCGATACGGTCGAGTACGCCAAGTGGAAGTCGTTCCGCGAGTCGGAGG
ATTCGCGCTACGTGGGCCTGACGATGCCGCGCTTCCTGGGCCGGCTGCCGTACAACCCCAAGGATGGCAC
CACCGTCGAGGGCTTCAACTTCGTCGAAGACGTGGACGGCACCGACCACAGCAAATACCTGTGGTGCAAC
GCCGCCTGGGCGTTCGGTGCGCGGCTGACCGCCGCGTTCGAAGACTTCGGCTGGTGCGCGGCGATCCGCG
GGGTGGAAGGCGGCGGGCTGGTCGAAGACCTGCCGACGCATACCTTCAAGACCGACGATGGCGAGATCGC
GCTCAAGTGCCCGACGGAAATCGCCATCACCGATCGCCGCGAGAAGGAGCTGAGCGACCTGGGCTTCATC
CCGCTCGTGCACTGCAAGAACTCGGACTATGCCGCGTTCTTCGCGGCGCAGTCGGTGCAGAAACCCAAGA
AGTACGACACCGACAGCGCGAACGCCAACGCGGTGCTGTCGGCGCAGTTGCAGTACATCTTTTCGGTATC
GCGCGTGGCGCACTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCGGCCAAGAACGTC
GAGACCTTCCTCAACCGGTGGATCTCGCAGTACGTCCTGCTGGACGACAACGCCACCCAGGAGCAGAAGG
CGCAATTCCCGCTGCGCGAAGCCTCGATCCAGGTGTCCGAAGTGCCCGGCAAGCCCGGTACGTACCGCTC
GGTGGCGTTCCTGCGGCCGCACTTCCAGCTCGATGAACTGTCGATCTCGCTGCGGCTGGTGGCGGACCTG
CCCAAGCCAACCAATTCCTGA
 Primer design