SecReT6
Protein ID: 386336075
SecReT6 ID620
T6SS typei4b
Gene symbolsciK
Locus tagRSPO_m01072
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1206167..1206670 [+]
Productsecretion system protein (evpc-like), hemolysin-coregulated protein
NoteTssD
UniProt IDF6G9C1
KEGG IDrsn:RSPO_m01072
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.00E-44, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|386336075|ref|YP_006032245.1| secretion system protein (evpc-like), hemolysin-coregulated protein [Ralstonia solanacearum Po82]
MKDIYVKFDSPAIKGESQDKDHKDWIEVNSWSQSIVQPRSATASTAGGHTAERCEHRDMVFTKDLDVVSP
LLYQHASGGTTFGEVSIEFFRADGEGNRVKYLEIKLKNAILSEVDSQVAAQGIPTDTFSLRYAAVQWKYT
QQKSAGGQGGNSQGAWSLTKNDKTYSV
 
Nucleotide Sequence: 504 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1206167-1206670 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGAAGGATATCTACGTCAAGTTCGACAGCCCGGCCATCAAGGGGGAGTCGCAGGACAAGGATCACAAGG
ACTGGATCGAAGTCAACAGCTGGTCCCAGTCGATCGTCCAGCCGCGTTCGGCTACGGCCTCGACCGCGGG
CGGCCACACCGCCGAGCGTTGCGAGCACCGCGACATGGTGTTCACCAAGGACCTGGACGTGGTCAGCCCG
CTGCTGTACCAGCACGCTTCGGGCGGTACGACCTTCGGTGAAGTGTCGATCGAGTTCTTCCGCGCCGACG
GCGAAGGCAACCGCGTGAAGTACCTCGAGATCAAGCTGAAAAACGCGATCCTGAGCGAAGTGGACTCGCA
GGTGGCTGCCCAGGGCATCCCGACCGACACGTTCAGCCTGCGCTATGCAGCCGTGCAGTGGAAGTACACG
CAGCAGAAGAGTGCCGGCGGCCAGGGCGGCAACTCGCAGGGCGCATGGAGCCTCACCAAGAACGACAAGA
CCTACTCGGTTTAA
 Primer design