SecReT6
Protein ID: 386336076
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01073
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1206731..1207204 [+]
Producthypothetical protein
NoteTssE
UniProt IDF6G9C2
KEGG IDrsn:RSPO_m01073
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.10E-19, Aligned region: 29..137
Protein Sequence: 157 a.a.     [Download]
>gi|386336076|ref|YP_006032246.1| hypothetical protein RSPO_m01073 [Ralstonia solanacearum Po82]
MKGFEPSLLDKLFDDEPHAPMPTALRQLSLEELKSTVARDIESLLNTRIVFEEDDLEGLPECKQSLLTYG
LNDFAGLSLVSFYDRNYICQSLTKAIERHEPRLQSVNVSLEINERATNALCFGISAVLLVGPAREPVSFD
AMLQPSTLRYSVSRGRG
 
Nucleotide Sequence: 474 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1206731-1207204 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGAAAGGCTTCGAACCCAGCCTGCTCGATAAGCTCTTCGACGACGAGCCGCATGCGCCCATGCCCACGG
CTCTGCGGCAGCTTTCGCTGGAAGAGCTCAAGAGCACGGTGGCGCGCGATATCGAGTCCTTGCTCAATAC
GCGCATCGTTTTTGAAGAGGACGACCTGGAAGGCCTGCCCGAATGCAAGCAGTCGCTGCTGACCTACGGG
CTGAACGATTTCGCGGGCCTGAGCCTCGTCAGCTTCTACGATCGCAACTACATCTGCCAGTCGCTCACCA
AGGCGATCGAGCGGCACGAGCCACGGCTGCAGAGCGTCAACGTCTCGCTGGAGATCAACGAGCGGGCGAC
CAACGCGCTGTGCTTCGGCATCAGTGCCGTCCTGCTGGTCGGGCCGGCGCGTGAGCCCGTGAGCTTCGAC
GCGATGCTGCAGCCGTCCACGCTGCGGTATTCCGTCTCGCGCGGGCGCGGCTGA
 Primer design