SecReT6
Protein ID: 386336077
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01074
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1207267..1209117 [+]
Producthypothetical protein
NoteTssF
UniProt IDF6G9C3
KEGG IDrsn:RSPO_m01074
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.10E-208, Aligned region: 4..615
Protein Sequence: 616 a.a.     [Download]
>gi|386336077|ref|YP_006032247.1| hypothetical protein RSPO_m01074 [Ralstonia solanacearum Po82]
MEELLPYYERELAFLRRYSRDFAERYPKIAGRLAMSGDGCDDPHVERMIESFSLLTARVSKKLDDDYPEF
TEALLEVLYPHYLRPFPSCSVVHFDVRGVAAQISAPMLIPRGTFLTSRVVRKVECRFRTAYDVTFAPVRI
AAAAFERAVSAPSAVSLPKGATGAIALTLEYVGERGGFESLPLDRLRVYMDGEPSFVAALGDALFLQTAA
AYVEGERPGVWTRLSGVPLQAVGFTEDEALIDCPPRSHPAYRLLTEHFSFAEKFNFFDIDLAAVRRGLTP
GVPVRQLVLHLVLKDVRSDSHAARLLEGLQADHLRLHCTPVVNLFQQMADPIRIEHTASAYPVVADSRRA
HGFDIYSIDKVHLVRETAAHEEVTEFRPFYSLHHGEEPGQSGHYWIARRNELVAQRSPGFETEISIVDTQ
FDPASPQTDTLSLTVTCTNRDLPSTLAFGQPEGDLSMEGGSIARSITFLRKPTPSMRLGGGRAAQWRLIS
LLALNHLSLVQNGLPTLKEMLRLHDLPHSAISARQVEGIVGLDYAPATRWLAGKPFATFVRGLEIRLTLD
EDAFVGTGLHRFIRVLDHFFGLYVHINSFVQLIAVSRRSGKELVRCAPRSGESILV
 
Nucleotide Sequence: 1851 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1207267-1209117 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGAAGAACTGCTGCCCTATTACGAACGAGAACTGGCCTTCCTGCGCCGGTACTCGCGCGACTTCGCCG
AGCGCTACCCGAAGATCGCCGGTCGCCTCGCCATGTCGGGCGACGGCTGCGACGATCCGCACGTCGAGCG
GATGATCGAGTCGTTCTCGCTGCTGACCGCGCGCGTCAGCAAGAAGCTGGACGACGACTACCCCGAATTC
ACCGAGGCGTTGCTGGAGGTCCTGTACCCCCACTACCTTCGCCCGTTCCCGTCGTGCTCCGTGGTGCATT
TCGACGTGCGCGGCGTGGCGGCGCAGATCAGCGCGCCGATGCTGATCCCGCGCGGCACGTTCCTGACTTC
GCGCGTGGTGCGCAAGGTCGAGTGCCGTTTCCGCACCGCCTACGATGTCACCTTCGCGCCGGTGCGGATC
GCTGCGGCCGCGTTCGAGCGCGCCGTGTCCGCGCCGTCGGCGGTCAGCTTGCCCAAGGGGGCGACCGGTG
CGATCGCGCTGACGCTGGAGTACGTCGGCGAGCGCGGCGGCTTCGAGTCCTTGCCGCTCGACCGGCTGCG
CGTCTACATGGACGGCGAGCCCTCGTTCGTGGCCGCGCTGGGGGATGCGCTGTTCCTGCAGACGGCGGCG
GCCTATGTGGAGGGCGAGCGCCCCGGCGTGTGGACCCGCCTGTCCGGCGTGCCGCTGCAAGCGGTCGGCT
TTACAGAAGACGAGGCGCTGATCGATTGCCCACCGCGCTCGCATCCGGCCTATCGGCTGCTGACCGAGCA
TTTCAGCTTTGCCGAGAAATTCAATTTCTTCGACATCGACCTGGCGGCCGTGCGGCGCGGGTTGACGCCC
GGCGTGCCGGTCCGCCAACTGGTGCTGCACCTGGTCCTGAAGGACGTGCGCAGCGACTCGCATGCCGCCC
GCCTGCTCGAGGGCCTGCAGGCCGACCACCTGCGCCTGCATTGCACGCCGGTGGTCAACCTGTTCCAGCA
GATGGCAGATCCGATCCGTATCGAGCACACGGCCAGCGCCTATCCGGTCGTGGCCGACAGCCGCCGCGCG
CACGGCTTCGATATCTACTCGATCGACAAGGTGCACCTGGTGCGCGAGACCGCCGCGCACGAAGAGGTGA
CCGAGTTCCGCCCGTTCTACTCGCTGCATCACGGCGAGGAGCCCGGGCAGTCGGGCCACTACTGGATCGC
GCGGCGCAACGAGCTGGTGGCGCAGCGCAGCCCCGGCTTCGAGACCGAGATTTCCATCGTCGATACGCAG
TTCGACCCGGCCAGCCCGCAGACCGATACGCTGAGCCTGACCGTCACCTGCACCAACCGCGATCTGCCGT
CCACGCTGGCATTCGGCCAGCCGGAGGGCGACCTGTCGATGGAGGGCGGCTCGATCGCCCGCAGCATCAC
GTTCCTGCGCAAGCCGACGCCGTCGATGCGGCTGGGCGGCGGGCGGGCGGCGCAGTGGCGGCTGATCTCG
CTGCTGGCGCTCAACCATCTGTCGCTGGTGCAGAACGGGCTGCCGACGCTCAAGGAGATGCTGCGCCTGC
ACGATCTGCCGCACAGCGCCATTTCGGCGCGGCAGGTCGAGGGCATCGTCGGTCTCGACTACGCGCCGGC
CACGCGCTGGCTGGCCGGCAAGCCGTTCGCCACCTTCGTGCGGGGGCTGGAGATCCGGCTCACGCTGGAC
GAAGACGCCTTTGTCGGCACGGGCCTGCATCGATTCATCCGCGTGCTGGACCACTTCTTCGGTCTGTACG
TCCACATCAACAGCTTTGTGCAGCTGATCGCGGTATCGCGCCGCAGCGGCAAGGAACTGGTCAGATGCGC
ACCCCGCAGCGGCGAATCGATCCTGGTGTGA
 Primer design