SecReT6
Protein ID: 386336078
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01075
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1209081..1210184 [+]
Producthypothetical protein
NoteTssG
UniProt IDF6G9C4
KEGG IDrsn:RSPO_m01075
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.20E-92, Aligned region: 18..348
Protein Sequence: 367 a.a.     [Download]
>gi|386336078|ref|YP_006032248.1| hypothetical protein RSPO_m01075 [Ralstonia solanacearum Po82]
MRTPQRRIDPGVIRRLLRQPYRYEFFQAVRLLEQLFARRGNAAPEHALATRVSFRNTLALSFPPSELQAI
EAGSVTPDMLESDAAFMAALDDGALDTVAITPTFFGMLGVQGALPLRYTEIVAEREAVWRDRAARAFFDM
FSNRATALFYLAWKKYRLPFQYEVDNNRHYLPLLLSLAGVTDRTLRSDLSGTPGPVHDEALAGYATAIRH
RPVSAAYLQRVLADYFQAPVRVEQFVGNWYRVPPSQYSRLGGTNNVLGATALAGERVWQRDLRVRVWVGP
LARAQYRNFLPGAPGALALRKMLTILCGATLEFEIKLILRRQDVAGCTLGAQAGGHGAGRLGWDTFLCSR
PAQHDRSDAQYTLEPLH
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1209081-1210184 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGCGCACCCCGCAGCGGCGAATCGATCCTGGTGTGATCCGCAGGCTGCTGCGGCAGCCGTACCGGTATG
AGTTCTTCCAGGCCGTACGGCTGCTGGAGCAGCTGTTTGCGCGCCGGGGCAATGCCGCCCCCGAGCATGC
GCTGGCCACGCGCGTGAGCTTCCGCAATACGCTGGCCCTGTCGTTCCCGCCCAGCGAGCTGCAGGCCATC
GAGGCCGGGAGCGTGACGCCTGACATGCTGGAGAGCGATGCGGCCTTCATGGCGGCGCTCGACGACGGCG
CGCTCGATACCGTGGCCATCACGCCGACCTTCTTCGGCATGCTCGGCGTTCAGGGGGCGCTGCCGCTGCG
CTATACCGAGATCGTGGCCGAGCGCGAGGCCGTGTGGCGCGACCGCGCGGCGCGGGCCTTTTTCGACATG
TTCTCGAACCGCGCGACGGCGCTGTTCTACCTGGCCTGGAAGAAGTACCGGCTGCCGTTCCAGTACGAAG
TCGACAACAACCGGCATTACCTGCCGCTGCTGCTGTCGCTGGCCGGCGTCACGGATCGCACGCTGCGCAG
CGATCTGTCCGGCACGCCGGGGCCGGTCCATGACGAAGCGCTGGCCGGCTATGCCACGGCGATCCGCCAT
CGGCCGGTGTCGGCGGCGTACCTGCAGCGGGTGCTGGCGGACTATTTCCAGGCGCCGGTGCGCGTCGAGC
AGTTCGTCGGCAACTGGTATCGCGTGCCGCCATCGCAGTATTCACGGCTGGGCGGCACCAACAACGTGCT
CGGCGCCACCGCGCTGGCCGGCGAGCGCGTCTGGCAGCGCGACCTGCGGGTGCGCGTGTGGGTCGGTCCG
CTGGCGCGCGCGCAGTACCGCAACTTCCTGCCGGGGGCGCCCGGTGCACTGGCGCTGCGCAAGATGCTGA
CGATCCTGTGCGGCGCCACGCTCGAATTCGAAATCAAGCTGATCCTGCGCCGCCAGGATGTGGCCGGCTG
CACGCTGGGCGCGCAGGCCGGTGGCCACGGTGCCGGCCGACTGGGCTGGGACACCTTCCTGTGCTCGCGT
CCGGCGCAGCACGACCGCAGCGACGCGCAGTACACCCTCGAACCGCTGCATTGA
 Primer design