SecReT6
Protein ID: 386336079
SecReT6 ID620
T6SS typei4b
Gene symbolclpB
Locus tagRSPO_m01076
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1210217..1212940 [+]
Productchaperone clpb
NoteTssH
UniProt IDF6G9C5
KEGG IDrsn:RSPO_m01076
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.70E-43, Aligned region: 231..312
AAA_2 [PF07724], Evalue: 2.70E-43, Aligned region: 637..804
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 231..344
AAA [PF00004], Evalue: 2.30E-19, Aligned region: 642..760
AAA_5 [PF07728], Evalue: 5.30E-13, Aligned region: 231..251
AAA_5 [PF07728], Evalue: 5.30E-13, Aligned region: 642..760
ClpB_D2-small [PF10431], Evalue: 3.70E-12, Aligned region: 385..402
ClpB_D2-small [PF10431], Evalue: 3.70E-12, Aligned region: 813..888
AAA_16 [PF13191], Evalue: 1.40E-10, Aligned region: 208..252
AAA_16 [PF13191], Evalue: 1.40E-10, Aligned region: 275..309
AAA_16 [PF13191], Evalue: 1.40E-10, Aligned region: 480..501
AAA_16 [PF13191], Evalue: 1.40E-10, Aligned region: 611..678
AAA_16 [PF13191], Evalue: 1.40E-10, Aligned region: 708..730
Clp_N [PF02861], Evalue: 3.10E-09, Aligned region: 23..74
Clp_N [PF02861], Evalue: 3.10E-09, Aligned region: 114..128
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 230..317
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 638..662
AAA_22 [PF13401], Evalue: 3.00E-07, Aligned region: 703..735
Sigma54_activat [PF00158], Evalue: 1.90E-06, Aligned region: 210..247
Sigma54_activat [PF00158], Evalue: 1.90E-06, Aligned region: 612..742
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 210..245
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 283..338
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 638..678
Arch_ATPase [PF01637], Evalue: 3.60E-05, Aligned region: 712..735
AAA_25 [PF13481], Evalue: 5.00E-05, Aligned region: 226..254
AAA_25 [PF13481], Evalue: 5.00E-05, Aligned region: 287..327
AAA_25 [PF13481], Evalue: 5.00E-05, Aligned region: 444..489
AAA_25 [PF13481], Evalue: 5.00E-05, Aligned region: 637..659
AAA_19 [PF13245], Evalue: 5.40E-05, Aligned region: 231..257
AAA_19 [PF13245], Evalue: 5.40E-05, Aligned region: 637..663
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 223..247
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 637..666
AAA_29 [PF13555], Evalue: 7.10E-05, Aligned region: 734..768
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 231..294
AAA_17 [PF13207], Evalue: 0.00012, Aligned region: 641..677
IstB_IS21 [PF01695], Evalue: 0.00021, Aligned region: 223..253
IstB_IS21 [PF01695], Evalue: 0.00021, Aligned region: 641..659
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 231..251
AAA_18 [PF13238], Evalue: 0.0015, Aligned region: 643..671
NACHT [PF05729], Evalue: 0.0017, Aligned region: 231..317
NACHT [PF05729], Evalue: 0.0017, Aligned region: 642..663
Zeta_toxin [PF06414], Evalue: 0.002, Aligned region: 231..251
Zeta_toxin [PF06414], Evalue: 0.002, Aligned region: 633..681
T2SE [PF00437], Evalue: 0.0023, Aligned region: 212..248
T2SE [PF00437], Evalue: 0.0023, Aligned region: 629..678
AAA_23 [PF13476], Evalue: 0.0064, Aligned region: 231..247
AAA_23 [PF13476], Evalue: 0.0064, Aligned region: 444..491
AAA_23 [PF13476], Evalue: 0.0064, Aligned region: 638..670
Protein Sequence: 907 a.a.     [Download]
>gi|386336079|ref|YP_006032249.1| chaperone clpb [Ralstonia solanacearum Po82]
MATPLKTLIAKLNATSRQAAEHAASLCMARGNYEVDLEHLFLALLESRRSDFAVAARASGIDLAALQRDL
EAEIARFQTGNTRTPAFSPYLPKLFEHAWLIASLDSQITRIRSGHLLLALLTEPSLAALAERGSRLFGRF
EVERLKHDFERMTAGSDEQEQAVDFADSTAAQTDDGRAPAAALSATPALDQFTVDLTQAAREGRIDPVIG
RDAEIRQVVDILMRRRQNNPILTGEAGVGKTAVVEGLALRVAANDVPPPLQGVTLRTLDMGLLQAGASVK
GEFENRLKNVIDEVKKSPKPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKKY
FEKDAALARRFQVVKVEEPSEPLAAAMLRGMAPLMERHFGVRVLDEAITEAVRLSHRYISGRQLPDKAVS
VLDTACAKVALGQSATPGAIEDDQKALERLLGEIAALQREQSAGAAHDARLDALQAKRAELEQRIAQNTE
RLAQERALVARIQALREAREGGAAQAGGQDAEPMAANSDVVAMPAKRGRAAAAPDSPDELTALLAELRAL
QGETPMVPLHVDGHVVSEIVSAWTGIPLGRMVKDELRTVLNLKPLLAARVIGQDHALQAIAQRVRTASAN
LEDPNKPRGVFLFAGPSGVGKTETALALADILYGGERKLVTINMSEYQEAHSVSGLKGSPPGYVGYGEGG
VLTEAVRRNPYSVVLLDEVEKAHPDVLEMFFQVFDKGEMDDAEGRPIDFRNTIIILTSNVGSSAIMQACL
NKPAEELPDADTLAETLRPVLYKTFKPAFLGRTKVVPYYPIADDVLAEIITLKLGRIRDRVAANHKATFQ
WDTALVESVLARCTEVDAGARAVDHILNGTLLPEIAEAVLTRMAEGGSVEKIKVSVGKTGEFKYRIN
 
Nucleotide Sequence: 2724 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1210217-1212940 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGCCACCCCACTCAAGACCTTGATCGCCAAGCTGAACGCGACCAGCCGGCAGGCTGCCGAGCACGCGG
CCTCGCTGTGCATGGCGCGCGGCAACTATGAAGTCGACCTGGAGCACCTGTTCCTGGCGCTGCTGGAAAG
CCGCCGCAGCGACTTCGCCGTGGCCGCGCGCGCCAGCGGCATCGACCTGGCGGCGCTGCAGCGCGACCTG
GAAGCCGAGATCGCGCGCTTCCAGACCGGCAACACGCGCACGCCGGCGTTCTCGCCGTATCTGCCCAAGC
TGTTCGAGCATGCGTGGCTGATCGCCTCGCTGGATTCGCAGATCACGCGCATCCGCTCGGGCCACCTGTT
GCTCGCGCTGCTGACCGAGCCCAGCCTGGCGGCGCTGGCCGAGCGCGGCTCGCGGCTGTTCGGCCGTTTC
GAGGTGGAGCGGCTCAAGCATGATTTCGAGCGCATGACCGCGGGCTCCGACGAGCAGGAACAGGCTGTCG
ATTTCGCAGACAGCACGGCCGCGCAGACCGATGACGGCCGCGCGCCCGCTGCCGCGCTGAGCGCGACTCC
GGCCCTCGACCAGTTCACCGTGGACCTGACGCAGGCCGCCCGCGAAGGCCGCATCGATCCTGTGATCGGA
CGCGATGCGGAGATCCGCCAGGTGGTCGACATCTTGATGCGCCGGCGCCAGAACAACCCGATCCTGACCG
GCGAGGCCGGCGTCGGCAAGACCGCGGTGGTGGAGGGCCTCGCGCTGCGCGTGGCCGCCAACGATGTGCC
GCCGCCGCTGCAGGGCGTCACGCTGCGCACGCTCGACATGGGCCTGCTGCAGGCCGGCGCGAGCGTGAAG
GGCGAATTCGAGAACCGCCTGAAGAACGTGATCGACGAGGTCAAGAAGAGCCCGAAGCCGATCATCCTGT
TCATCGACGAGGCGCACACCATCATCGGCGCGGGCGGGCAGGCCGGCCAGAACGATGCGGCCAACCTGCT
CAAGCCAGCGCTGGCGCGCGGGGAGCTGCGCACCATTGCCGCGACCACGTGGAGCGAGTACAAGAAGTAC
TTCGAAAAGGACGCCGCCCTCGCACGCCGCTTCCAGGTCGTCAAGGTCGAAGAGCCCAGCGAGCCGCTGG
CCGCGGCCATGCTGCGCGGCATGGCACCGCTGATGGAGCGCCACTTCGGCGTGCGCGTGCTGGACGAGGC
CATTACCGAGGCCGTGCGCCTGTCGCACCGGTATATCAGCGGGCGCCAGTTGCCGGACAAGGCCGTCAGC
GTGCTGGACACGGCGTGCGCCAAGGTGGCCCTGGGCCAGAGCGCCACGCCGGGCGCCATCGAAGACGACC
AGAAAGCGCTGGAACGCCTGCTGGGCGAGATTGCAGCGCTGCAGCGCGAGCAGAGCGCCGGCGCCGCGCA
CGATGCCCGCCTGGACGCACTGCAGGCCAAGCGGGCCGAGCTGGAACAGCGCATCGCGCAGAACACCGAG
CGCCTGGCCCAGGAGCGCGCCCTGGTGGCGCGCATCCAGGCGCTGCGCGAGGCCCGTGAAGGCGGTGCCG
CGCAAGCCGGTGGGCAGGACGCGGAGCCGATGGCGGCCAACAGCGACGTGGTCGCGATGCCGGCCAAGCG
CGGCCGTGCCGCCGCCGCGCCGGACTCGCCGGACGAACTGACCGCGCTGCTCGCCGAGCTGCGCGCGCTG
CAGGGCGAAACGCCCATGGTGCCGCTGCACGTGGACGGCCATGTCGTGTCGGAGATCGTCTCGGCCTGGA
CCGGCATTCCGCTGGGCCGCATGGTCAAGGACGAACTGCGTACCGTGCTCAACCTCAAGCCGCTGCTGGC
CGCGCGCGTGATCGGCCAGGATCACGCGCTGCAGGCCATCGCCCAGCGCGTGCGCACCGCCTCGGCCAAC
CTGGAAGATCCGAACAAGCCGCGCGGCGTGTTCCTGTTCGCCGGTCCGTCCGGCGTGGGCAAGACCGAGA
CGGCGCTGGCGCTGGCCGACATCCTCTACGGCGGCGAGCGCAAGCTCGTCACCATCAACATGAGCGAGTA
CCAGGAGGCGCACAGCGTCTCGGGCCTGAAGGGCTCGCCGCCGGGCTACGTGGGCTACGGCGAGGGCGGT
GTGTTGACCGAGGCGGTGCGCCGCAACCCGTACAGCGTGGTGCTGCTGGACGAAGTCGAGAAAGCCCACC
CCGACGTGCTGGAGATGTTCTTCCAGGTGTTCGACAAGGGCGAGATGGACGACGCCGAAGGCCGCCCCAT
CGACTTCCGCAACACCATCATCATCCTGACCTCGAACGTGGGTTCGTCGGCCATCATGCAGGCCTGCCTG
AACAAGCCGGCCGAGGAACTGCCCGACGCCGACACCCTGGCCGAGACGCTGCGGCCGGTGCTGTACAAGA
CCTTCAAGCCGGCCTTCCTGGGGCGGACCAAGGTGGTGCCGTACTACCCGATCGCCGACGACGTGCTGGC
CGAGATCATCACGCTCAAGCTCGGCCGCATCCGCGACCGCGTGGCCGCCAACCACAAGGCGACGTTCCAG
TGGGACACCGCGCTGGTGGAATCCGTGCTGGCCCGCTGCACCGAAGTGGACGCGGGCGCGCGCGCGGTCG
ACCACATCCTCAACGGCACGCTGCTGCCCGAGATCGCCGAAGCGGTGCTCACGCGCATGGCCGAAGGCGG
CAGCGTCGAGAAGATCAAGGTCAGCGTCGGCAAGACCGGCGAGTTCAAGTACCGCATCAACTGA
 Primer design