SecReT6
Protein ID: 386336080
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01077
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1212977..1213861 [+]
ProductVgrG protein
NoteTssI
UniProt IDF6G9C6
KEGG IDrsn:RSPO_m01077
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.90E-42, Aligned region: 42..263
Protein Sequence: 294 a.a.     [Download]
>gi|386336080|ref|YP_006032250.1| VgrG protein [Ralstonia solanacearum Po82]
MVPPTELANLLRSAFTQADRLLRLETPLGPNALLPERLDAAEHLDEGGFRLELTALSDDADLDPARLLGQ
PVRLDLLTQLSRSTLRPFHGHVTRFEQLGANGGLVRYRLVVEPWLAFLRHRRDSFLFQDMSVIEVIDSLF
GDYNGQGRLTPAWRWSLHDTSVYTRRSVITQYEESDFDFASRLLAEEGLFYFFEHEVVQGRGAGRAPHGD
RRCQRRVRRQRAGCHPLRSRRCHRQRRRDRPLAGRTALADQRRVGRQLGLPRQRQAQRPARRAAARRRSA
VDAAGHRLPRPVRV
 
Nucleotide Sequence: 885 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1212977-1213861 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGTCCCACCGACCGAGCTGGCCAACCTGCTGCGGTCGGCCTTCACCCAGGCGGACCGGCTGTTGCGCC
TGGAAACGCCGCTCGGGCCGAACGCGCTGCTGCCCGAGCGGCTGGACGCCGCCGAGCACCTGGACGAGGG
CGGTTTCCGGCTGGAGCTGACGGCGCTGTCCGACGACGCCGATCTCGACCCGGCGCGCTTGCTGGGGCAG
CCCGTCCGGCTCGATTTGCTGACCCAACTGAGCCGCAGCACGCTGCGGCCGTTCCATGGCCACGTCACGC
GGTTCGAGCAGTTGGGCGCCAACGGCGGGCTGGTGCGCTACCGATTGGTGGTCGAGCCGTGGCTGGCCTT
CCTGCGCCACCGGCGCGACAGTTTCCTGTTCCAGGACATGTCGGTCATCGAGGTGATTGACAGCCTGTTC
GGCGACTACAACGGCCAGGGTCGCCTGACGCCGGCGTGGCGCTGGTCGTTGCACGATACCTCGGTGTACA
CGCGCCGCAGCGTCATCACGCAATACGAAGAAAGCGATTTCGATTTCGCCTCCCGCCTGCTGGCCGAGGA
AGGGCTGTTCTATTTCTTCGAGCACGAGGTGGTGCAGGGGCGAGGCGCTGGGCGTGCACCGCATGGTGAT
CGCCGATGCCAACGACGTGTTCGTCGACAACGCGCAGGCTGCCATCCGCTTCGGTCGCGCCGATGCCACC
GCCAGCGAAGACGTGATCGACCGCTGGCAGGGCGTACGGCGCTGGCAGACCAACGCCGTGTCGGTCGCCA
GCTGGGACTACCGCGCCAACGCCAAGCGCAGCGCCCAGCTCGGCGCGCAGCAGCGCGGCGGCGGTCCGCA
GTTGACGCTGCAGGACACCGATTACCCCGGCCAGTACGGGTTTGA
 Primer design