SecReT6
Protein ID: 386336081
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01078
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1213599..1214219 [+]
Productvgr-related protein
NoteTssI
UniProt IDF6G9C7
KEGG IDrsn:RSPO_m01078
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.90E-23, Aligned region: 1..154
Protein Sequence: 206 a.a.     [Download]
>gi|386336081|ref|YP_006032251.1| vgr-related protein, partial [Ralstonia solanacearum Po82]
MVIADANDVFVDNAQAAIRFGRADATASEDVIDRWQGVRRWQTNAVSVASWDYRANAKRSAQLGAQQRGG
GPQLTLQDTDYPGQYGFEDNAQAQHSARIVMEALELRGRQFDGEGSARTLAPGTCFQLADHYGQDGAGED
RFAVLSVAHRVRNNFNERFGQVLARTLGALAGLDALGGAGNAGTDGDATFYRNHFTVVRDSVPPAA
 
Nucleotide Sequence: 621 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1213599-1214219 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGTGATCGCCGATGCCAACGACGTGTTCGTCGACAACGCGCAGGCTGCCATCCGCTTCGGTCGCGCCG
ATGCCACCGCCAGCGAAGACGTGATCGACCGCTGGCAGGGCGTACGGCGCTGGCAGACCAACGCCGTGTC
GGTCGCCAGCTGGGACTACCGCGCCAACGCCAAGCGCAGCGCCCAGCTCGGCGCGCAGCAGCGCGGCGGC
GGTCCGCAGTTGACGCTGCAGGACACCGATTACCCCGGCCAGTACGGGTTTGAAGACAACGCCCAGGCCC
AGCACAGCGCGCGCATCGTGATGGAAGCGCTGGAGCTGCGCGGCCGGCAGTTCGACGGCGAAGGCAGCGC
GCGCACGCTGGCGCCCGGCACGTGCTTCCAGTTGGCTGACCACTACGGCCAGGATGGCGCGGGGGAGGAC
CGCTTCGCCGTGCTGTCCGTGGCGCATCGGGTGCGCAACAACTTCAACGAGCGCTTCGGGCAGGTGCTGG
CGCGGACGCTGGGGGCGCTGGCCGGGCTCGATGCGCTGGGCGGTGCGGGCAACGCCGGCACCGACGGCGA
CGCCACGTTCTATCGGAACCACTTCACGGTCGTGCGCGACAGCGTGCCGCCCGCAGCGTAG
 Primer design