SecReT6
Protein ID: 386336087
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01085
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1219458..1220537 [+]
Producthypothetical protein
NoteTssA
UniProt IDF6G9D3
KEGG IDrsn:RSPO_m01085
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-26, Aligned region: 56..117
ImpA-rel_N [PF06812], Evalue: 2.00E-26, Aligned region: 225..249
Protein Sequence: 359 a.a.     [Download]
>gi|386336087|ref|YP_006032257.1| hypothetical protein RSPO_m01085 [Ralstonia solanacearum Po82]
MATLQLDQLLAPLSGPTPCGEDMLFSSEFDAIQDARRFDDPSLDQGEWVTEIKEADWRTVVAESTALLQT
RTKDLRLAAWLTEALSKERGFTGLREGYELIAGLCEQYWEHLFPLPEPDDPEARTGSMVWLAVRSSQLVR
EVPLVDAGKGGFNYIDWEVATNLVEAIRRDPDQADELSRGKVTQEQFESARRATPAAFYTTLHSDVVGCG
AALLRLESVLDARAADHAPSFRAAREALQAVRALVERFGGRTETKPNANGAKTPVVPQQTAQPVAEAEPD
TVIGPIRTRAQALNQLREVAEFFRQTEPHSPVAYLAARAAKWGDMPLHAWLRTVVKDDATLSQIEELLGL
GDPPVDSAS
 
Nucleotide Sequence: 1080 bp     [Download]
>gi|386335008|ref|NC_017575.1|:1219458-1220537 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGGCAACCCTCCAGCTCGACCAGCTTCTCGCCCCGCTCTCCGGCCCCACGCCTTGCGGCGAGGACATGC
TGTTCTCCTCCGAATTCGACGCCATCCAGGACGCGCGCCGCTTCGACGACCCCTCGCTCGACCAGGGCGA
GTGGGTGACCGAGATCAAGGAAGCGGACTGGCGCACCGTCGTCGCGGAAAGCACGGCGCTGCTGCAGACG
CGCACCAAAGACCTGCGCCTGGCCGCGTGGCTGACCGAGGCCCTGTCCAAGGAGCGCGGCTTTACCGGCC
TGCGCGAGGGCTACGAGCTGATCGCGGGCTTGTGCGAGCAGTACTGGGAGCACCTCTTCCCGCTGCCCGA
GCCGGACGACCCCGAAGCGCGCACCGGTAGCATGGTGTGGCTGGCGGTGCGCTCCAGCCAACTGGTCCGC
GAGGTGCCGCTGGTGGATGCGGGCAAGGGCGGCTTCAACTATATCGATTGGGAAGTCGCCACCAACCTGG
TCGAGGCGATCCGGCGTGATCCGGACCAGGCGGATGAGCTGTCGCGCGGCAAGGTCACGCAGGAGCAGTT
CGAGTCGGCGCGGCGCGCCACGCCGGCGGCGTTCTACACGACCTTGCACAGCGACGTGGTCGGTTGCGGC
GCGGCGCTGCTGCGGCTGGAATCCGTGCTGGATGCCCGCGCCGCGGACCACGCGCCCAGCTTCCGCGCCG
CGCGCGAGGCGCTGCAGGCGGTGCGCGCCCTGGTCGAGCGCTTCGGCGGCAGGACCGAGACCAAGCCGAA
TGCGAACGGGGCCAAGACGCCCGTCGTGCCGCAGCAGACCGCCCAGCCCGTCGCCGAGGCCGAGCCCGAC
ACCGTGATCGGCCCGATCCGCACCCGCGCCCAGGCGCTGAACCAACTGCGCGAGGTGGCCGAGTTCTTCC
GCCAGACCGAGCCGCACAGCCCGGTGGCTTACCTTGCCGCGCGCGCGGCCAAGTGGGGCGACATGCCGCT
GCATGCCTGGCTGCGCACGGTGGTCAAGGACGATGCGACGCTGTCGCAGATCGAGGAACTGTTGGGGTTG
GGCGATCCGCCCGTCGACAGCGCGAGCTGA
 Primer design