SecReT6
Protein ID: 386336088
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01087
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1220595..1221437 [-]
Productpeptidoglycan-associated lipoprotein
NoteTagL
UniProt IDF6G9D4, F6G9D4
KEGG IDrsn:RSPO_m01087
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 3.30E-24, Aligned region: 120..161
OmpA [PF00691], Evalue: 3.30E-24, Aligned region: 178..272
BON [PF04972], Evalue: 0.0019, Aligned region: 50..88
BON [PF04972], Evalue: 0.0019, Aligned region: 121..159
Protein Sequence: 280 a.a.     [Download]
>gi|386336088|ref|YP_006032258.1| peptidoglycan-associated lipoprotein [Ralstonia solanacearum Po82]
MNMGLDAIKHGFRPAVLALATTAACLGAALPAYGAPGDPAPATTANPVPGGQVVAGGMVPDEATKASVLA
RLRELYGSANVVDQIEVGNVVSPPNWTGNVQKILSPQIKQVNRGQLNIDGTQVAVHGDVQNEAQRQQLAS
DMATTLGASYTIKNGLRVAAISEQSLLDQTLANRIIEFETGSATLTPKGRGILDEMAAVLPRLNGRKIEI
VGHTDNSGSRAMNLNLSQARAETVKSYLINKGAEPGTLTAIGVGPDQPVAANTTDEGRSRNRRIEFRASQ
 
Nucleotide Sequence: 843 bp     [Download]
>gi|386335008|ref|NC_017575.1|:c1221437-1220595 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGAACATGGGTCTGGATGCAATCAAGCACGGCTTCCGGCCTGCGGTCCTGGCGCTCGCCACCACGGCCG
CCTGCCTGGGCGCGGCCCTGCCCGCATACGGCGCGCCCGGCGACCCCGCCCCGGCAACCACGGCAAACCC
CGTGCCGGGCGGCCAAGTGGTGGCCGGCGGCATGGTCCCGGACGAGGCCACCAAGGCGAGCGTGCTGGCC
CGGCTGCGCGAGCTCTACGGCAGCGCCAACGTGGTCGACCAGATCGAGGTCGGCAACGTGGTGTCGCCGC
CCAACTGGACGGGCAATGTGCAGAAAATCCTGTCGCCGCAGATCAAGCAGGTCAACCGCGGCCAGTTGAA
CATCGACGGCACGCAAGTGGCCGTGCACGGCGACGTGCAGAACGAGGCGCAGCGCCAGCAGCTCGCCAGC
GACATGGCCACCACGCTCGGCGCCAGCTACACGATCAAGAACGGCCTGCGCGTGGCCGCCATCTCGGAGC
AGAGCCTGCTGGACCAGACCCTGGCCAACCGCATCATCGAGTTCGAGACCGGCAGCGCCACGCTCACGCC
CAAGGGGCGCGGCATCCTGGATGAAATGGCCGCCGTGCTGCCGCGCCTGAACGGCCGCAAGATCGAGATC
GTCGGCCACACCGACAACTCGGGCAGCCGCGCCATGAACCTCAACCTGAGCCAGGCCCGCGCCGAGACGG
TGAAAAGCTACCTGATCAACAAGGGCGCCGAGCCCGGCACGCTGACCGCCATCGGTGTCGGGCCGGACCA
GCCGGTGGCGGCAAACACCACCGACGAGGGACGGTCGCGCAATCGGCGCATTGAGTTCCGCGCGAGCCAA
TAA
 Primer design