SecReT6
Protein ID: 386336090
SecReT6 ID620
T6SS typei4b
Gene symbolicmF
Locus tagRSPO_m01088
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1222417..1226352 [-]
Producttransmembrane protein
NoteTssM
UniProt IDF6G9D6
KEGG IDrsn:RSPO_m01088
PDB IDNA
Domain hit(s) vs Pfam ImcF-related_N [PF14331], Evalue: 2.60E-73, Aligned region: 81..102
ImcF-related_N [PF14331], Evalue: 2.60E-73, Aligned region: 183..441
IcmF-related [PF06761], Evalue: 1.10E-51, Aligned region: 488..860
DUF1215 [PF06744], Evalue: 1.30E-27, Aligned region: 996..1109
O-antigen_lig [PF13425], Evalue: 0.0087, Aligned region: 7..60
O-antigen_lig [PF13425], Evalue: 0.0087, Aligned region: 433..495
Protein Sequence: 1311 a.a.     [Download]
>gi|386336090|ref|YP_006032260.1| transmembrane protein [Ralstonia solanacearum Po82]
MQRFLNFLTHSRTLSILGVIVVTIFLLLMAQTFEIGLVWAGIALGALLVLWLASALWKRWRARRASARLE
GALEQSADKSSAPDKREEVEALRVRLAEAVKTIKRSKLGQLSGDAALYELPWYIVIGNPAAGKSTAVLNS
GLQFPFADKGGAVIQGIGGTRNCDWFFTTEGILLDTAGRYSVHEEDRREWLGFLDLLKRYRPKAPINGIV
VTVSVSELTQNRPEFAINLAKNLRQRVQELTERLEVFAPVYVMFTKADLITGFTEFFGDSEKQERDRVWG
ASLPFEPDAKPDVAALFDQRFDELCDGLKEISVAQIALHQKNKLSPGLLSFPLEFASIKPALRSFLVTLF
DENPFQYKPVFRGFYFTSALQEGATNSASAERIARRFGLSTDGAARSREVFSKNGFFLRDLFSKVIFSDR
HTVRQFASPAKTRLRIATFFGLVLALGLLLGGWTWSYMGNRTLTANVQADLDKIVKLQQNRVDLQARLEA
LDILQDRIEQLERFRGEHPLALSLGLYQGDALQHKLLDEYYNGLRQVMLKPVGGALETFLADVNAHPDQL
APMVRPPETGAVIATSVTSATATVATSGAAANAPASPAATATAAAGKRFTDASPTNVEDGYNALKTYLML
SDKRHVEVAHLTDQITRFWRGWLEDNRGNMPREQMIRSAERNLSFFLARVNDDNWPLLEGNLSLIDQTRE
NLRRVVRGMPARERAYAEIKARASTRYAPMTVARIVGETGSNVIAGSYAVPGTFTKEAWQGYVQGAIREA
ASKELQTKDWVLNVAARDDLTLEGSPEQIQKTLVTMYKTEYAHEWQRFMQGVAIQDFSGFDQAVAGMNLL
GDPTNSPIRKVLDTAYDQTSWDNPSMFNAGLKQAKSGTLGWFKQLFSWQTPSQINVNVDVGGNADAGTLP
MGPVGKEFAGLARVVMVRDDRSLLRGYMDALSKVRTRFNLIKNQGDPGPGARQLMQQTLDGNGSELADTL
KYVDEQMLTGMTDSERQTLRPLLVRPLLQSYAVVVRPASVEINKVWNAQVYQPFSQTLADKYPFAANAKI
EASAAEIGQIFGPEGAIAKFANTTIGPLSVRRGDMLAARTWGDLGLAFVPEFTSGFTRWIAPLTGGAAGG
AGGAAAAAPQTVFQILPVPSQGTTEYTIEIDGQQLRYRNTPPQWANFVWPNPQGAPGARVSATTFDGRTV
ELLNEPGRFGLERLIATANRKRRPDGAFDLTWARDGISVSVSLRIISSPQTAGASASDSPQGQGLRGLRL
PTSIADANASQNASTPPAPAGSRPASTPAATTQAATTARSTVAQEQGGLAQ
 
Nucleotide Sequence: 3936 bp     [Download]
>gi|386335008|ref|NC_017575.1|:c1226352-1222417 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGCAACGTTTCCTCAACTTCCTGACCCACTCACGCACGCTCTCGATCCTGGGCGTGATCGTGGTGACGA
TCTTCCTGCTGCTGATGGCGCAGACCTTCGAGATTGGCCTGGTCTGGGCCGGCATCGCGCTCGGCGCGCT
GCTGGTGCTATGGCTGGCGAGCGCACTGTGGAAACGCTGGCGCGCGCGCCGCGCGAGCGCCCGCCTGGAA
GGCGCGCTGGAGCAGTCGGCCGACAAGTCCAGCGCCCCCGACAAGCGCGAGGAGGTCGAAGCCCTGCGCG
TGCGCCTGGCCGAGGCGGTCAAGACCATCAAGCGCTCCAAGCTCGGGCAGTTGTCCGGCGACGCGGCGCT
CTATGAACTGCCCTGGTACATCGTGATCGGCAACCCGGCGGCCGGCAAGAGCACGGCGGTGCTGAACTCG
GGCCTGCAGTTTCCGTTCGCCGACAAGGGCGGCGCGGTGATCCAGGGCATCGGCGGCACGCGCAACTGCG
ACTGGTTCTTCACCACCGAAGGCATCCTGCTCGACACGGCCGGCCGCTACTCGGTGCACGAGGAAGACCG
CCGCGAATGGCTCGGCTTCCTGGACCTGCTCAAGCGCTACCGTCCCAAGGCGCCGATCAACGGCATCGTG
GTGACGGTAAGCGTGTCGGAGCTGACGCAGAACCGCCCCGAGTTCGCCATCAACCTCGCCAAAAACCTGC
GCCAGCGCGTGCAGGAGCTGACCGAGCGGCTGGAAGTGTTCGCCCCGGTCTACGTGATGTTCACCAAGGC
CGACCTGATCACCGGCTTCACGGAATTCTTCGGCGACAGCGAGAAGCAGGAGCGCGACCGCGTCTGGGGC
GCCAGCCTGCCGTTCGAGCCGGATGCCAAGCCCGATGTGGCGGCGCTGTTCGACCAGCGCTTCGATGAGC
TGTGCGACGGCCTGAAGGAAATCAGCGTGGCGCAGATCGCGCTGCACCAGAAGAACAAGCTGTCGCCGGG
GCTGCTGAGCTTTCCGCTGGAGTTCGCGTCGATCAAGCCGGCGCTGCGCAGCTTCCTGGTGACGCTGTTC
GACGAAAACCCCTTCCAGTACAAGCCGGTGTTCCGCGGCTTCTACTTCACCAGCGCGCTGCAGGAAGGCG
CCACCAACAGCGCTTCGGCCGAGCGCATCGCGCGCCGCTTCGGCCTGTCCACGGACGGCGCCGCGCGCAG
CCGCGAGGTGTTCTCCAAGAACGGCTTCTTCCTGCGCGACCTGTTCTCCAAGGTCATCTTCTCCGACCGC
CACACCGTGCGGCAGTTTGCCAGCCCGGCCAAGACGCGGCTGCGCATCGCCACATTCTTCGGGCTGGTGC
TGGCACTGGGCCTGCTGCTGGGCGGCTGGACGTGGTCGTACATGGGCAACCGCACGCTGACCGCCAACGT
GCAGGCCGACCTGGACAAGATCGTCAAGCTGCAGCAGAACCGCGTGGACCTGCAGGCCCGGCTGGAAGCG
CTGGACATCCTGCAGGACCGCATCGAACAGCTCGAACGCTTCCGCGGCGAGCATCCGCTGGCGCTGTCGC
TGGGGCTGTACCAGGGCGACGCGCTGCAGCACAAGCTGCTCGACGAGTACTACAACGGCCTGCGCCAGGT
GATGCTCAAGCCGGTGGGCGGCGCGCTCGAGACCTTCCTGGCGGACGTCAACGCGCACCCCGACCAGCTC
GCACCGATGGTGCGCCCGCCCGAGACCGGCGCGGTGATCGCCACCTCGGTCACCTCGGCGACGGCCACCG
TGGCGACTTCGGGCGCCGCCGCCAATGCGCCGGCATCGCCCGCGGCCACGGCCACCGCAGCGGCCGGCAA
GCGCTTCACCGATGCCTCGCCCACCAACGTGGAAGACGGCTACAACGCGCTCAAAACCTACCTGATGCTG
TCGGACAAGCGCCACGTGGAAGTCGCGCACCTGACCGACCAGATCACGCGCTTCTGGCGCGGCTGGCTGG
AAGACAACCGGGGCAACATGCCGCGCGAGCAGATGATCCGCTCGGCCGAGCGCAACCTGTCGTTCTTCCT
GGCCCGCGTGAACGATGACAACTGGCCGCTGCTGGAAGGCAACCTGTCGCTGATCGACCAGACCCGCGAG
AACCTGCGCCGCGTGGTGCGCGGCATGCCGGCGCGCGAGCGTGCCTATGCCGAGATCAAGGCCCGCGCCT
CGACCCGCTACGCACCGATGACGGTCGCACGCATCGTCGGCGAGACCGGCTCCAACGTGATCGCCGGCAG
CTACGCCGTGCCCGGCACCTTCACCAAGGAGGCGTGGCAAGGCTATGTGCAGGGCGCCATCCGCGAAGCC
GCCAGCAAGGAGCTGCAGACCAAGGACTGGGTGCTCAACGTGGCCGCCCGCGACGACCTGACGCTGGAAG
GCAGCCCCGAGCAGATCCAGAAGACCCTGGTCACGATGTACAAGACCGAGTACGCCCACGAATGGCAGCG
CTTCATGCAGGGCGTGGCCATCCAGGACTTCAGCGGCTTCGACCAGGCCGTGGCCGGCATGAACCTGCTG
GGCGATCCGACCAACTCGCCGATCCGCAAGGTGCTCGACACCGCCTACGACCAGACCTCGTGGGACAACC
CGTCCATGTTCAACGCCGGCCTGAAGCAGGCCAAGTCGGGCACGCTGGGCTGGTTCAAGCAGCTCTTCTC
GTGGCAGACGCCGTCGCAGATCAACGTCAACGTGGACGTGGGCGGCAACGCCGATGCCGGCACCCTTCCG
ATGGGGCCGGTGGGCAAGGAGTTCGCCGGGCTGGCGCGCGTGGTGATGGTGCGCGACGACAGGTCGCTGC
TGCGCGGCTACATGGATGCGCTGTCCAAGGTGCGCACCCGCTTCAACCTCATCAAGAACCAGGGCGACCC
CGGCCCCGGCGCGCGCCAGTTGATGCAGCAGACGCTGGACGGCAACGGCTCCGAGCTGGCCGACACCCTC
AAGTACGTCGATGAGCAGATGCTGACCGGCATGACCGACAGCGAACGCCAGACGCTGCGCCCGCTGCTGG
TGCGTCCGCTGCTGCAGTCGTACGCGGTGGTGGTCCGCCCGGCCAGCGTGGAAATCAACAAGGTGTGGAA
CGCGCAGGTCTACCAGCCGTTCAGCCAGACGCTGGCCGACAAGTATCCGTTCGCCGCCAACGCCAAGATC
GAGGCCAGCGCGGCCGAGATCGGCCAGATCTTCGGGCCGGAAGGCGCCATCGCCAAGTTCGCCAACACGA
CCATCGGCCCGCTGTCGGTGCGCCGCGGCGACATGCTGGCCGCGCGCACCTGGGGCGACCTGGGCCTGGC
CTTCGTGCCCGAGTTCACCTCCGGCTTCACGCGCTGGATCGCCCCGCTGACGGGCGGTGCGGCGGGCGGC
GCCGGTGGCGCGGCCGCTGCGGCGCCGCAGACGGTGTTCCAGATCCTGCCGGTGCCGTCGCAGGGCACCA
CCGAATACACCATCGAAATCGACGGCCAGCAATTGCGCTACCGCAACACGCCGCCGCAATGGGCCAACTT
CGTCTGGCCGAATCCGCAGGGTGCGCCGGGTGCGCGCGTGTCGGCCACGACCTTCGACGGCCGCACGGTG
GAGCTGCTCAACGAGCCGGGCCGCTTCGGCCTGGAGCGCCTGATCGCCACCGCGAACCGCAAGCGCCGCC
CCGATGGCGCGTTCGACCTGACGTGGGCGCGTGACGGCATCAGCGTGTCGGTCAGCCTGCGCATCATCAG
CAGCCCGCAGACGGCCGGCGCGTCGGCCTCCGATTCGCCGCAGGGCCAGGGCCTGCGCGGCCTGCGCCTG
CCGACCTCCATCGCCGATGCGAACGCCTCGCAAAACGCCTCCACGCCGCCGGCGCCGGCGGGCAGCCGCC
CGGCCAGCACGCCCGCCGCGACGACCCAGGCTGCGACCACTGCCCGGTCCACCGTCGCGCAAGAGCAAGG
GGGGCTGGCGCAATGA
 Primer design