SecReT6
Protein ID: 386336092
SecReT6 ID620
T6SS typei4b
Gene symbol-
Locus tagRSPO_m01090
StrainRalstonia solanacearum Po82
Repliconmegaplasmid [GenBank: NC_017575] [Browse all T6SS(s) in this replicon]
Location [Strand]1227896..1228165 [-]
Producthypothetical protein
NotePAAR
UniProt IDF6G9D8
KEGG IDrsn:RSPO_m01090
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 2.30E-24, Aligned region: 8..82
DUF4150 [PF13665], Evalue: 0.0036, Aligned region: 18..40
DUF4150 [PF13665], Evalue: 0.0036, Aligned region: 46..74
Protein Sequence: 89 a.a.     [Download]
>gi|386336092|ref|YP_006032262.1| hypothetical protein RSPO_m01090 [Ralstonia solanacearum Po82]
MTRPFILLGDKTDHGGVVITASGNTIAGGKGIACVGDKVTCPKSGHGGTTVIVTGDPTVVIDGRLAARHG
DKTACGATLLASQGTTGSI
 
Nucleotide Sequence: 270 bp     [Download]
>gi|386335008|ref|NC_017575.1|:c1228165-1227896 Ralstonia solanacearum Po82 megaplasmid, complete sequence
ATGACACGTCCTTTCATCCTCCTGGGCGACAAGACCGACCACGGCGGCGTGGTAATCACCGCATCGGGCA
ACACGATCGCCGGCGGCAAGGGCATCGCGTGCGTTGGCGACAAAGTCACGTGTCCGAAGTCGGGCCACGG
CGGCACGACCGTCATCGTCACGGGGGACCCGACCGTCGTCATCGATGGACGGCTGGCCGCACGCCATGGC
GACAAGACGGCCTGCGGCGCCACCCTCCTGGCCAGCCAGGGCACCACCGGCAGCATCTGA
 Primer design