SecReT6
Protein ID: 386590151
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0908
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1047106..1048155 [-]
ProductComponent of the type VI protein secretion system
NoteTssA
UniProt IDI0A5M0
KEGG IDshb:SU5_0908
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.00E-18, Aligned region: 49..108
ImpA-rel_N [PF06812], Evalue: 2.00E-18, Aligned region: 222..239
Protein Sequence: 349 a.a.     [Download]
>gi|386590151|ref|YP_006086551.1| Component of the type VI protein secretion system [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MSLTKPVSAEQPCGPDPEYDPEYLLLFSRAAPQAEAQYGDFVSTPEAVNWPEIERDARRLLTRSKDIRVL
ILLLRSRIQQAGAQGLAEILTQLAELSVIWSDALHPQLLTGEGASAESIEDAALARSNALAALLDHEGVM
ADIRGITLSNSAVLRLQVRDVERALSAPRPADALAPESVRQQLADLEARGALPLAAFREAQESAERLQVW
ARETLGDLAPDFSRLRQLLALLPDVVQTTTPEIPPSPAPVPDPAGTVMDNAVPARAEDVPPVNAPPGISL
PHNAEPGPIRDRNDALERLRCIRRWFESSEPSSPTIPLLRQAERLVGKRFSEVINEIPVELLEKWDALE
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|386589256|ref|NC_017623.1|:c1048155-1047106 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGTCCCTGACTAAACCGGTAAGCGCGGAACAACCCTGCGGCCCCGATCCGGAGTACGACCCGGAATACC
TGCTGCTGTTCAGTCGCGCCGCCCCCCAGGCGGAGGCGCAATATGGTGATTTTGTCAGTACGCCGGAAGC
CGTGAACTGGCCGGAAATTGAACGTGATGCGCGCCGTCTGCTCACGCGCAGTAAGGATATCCGGGTGTTG
ATCCTGCTGCTGCGCAGTCGCATCCAGCAGGCTGGCGCACAGGGACTGGCGGAAATACTCACACAACTGG
CAGAACTGAGCGTAATCTGGTCCGATGCACTCCATCCACAGCTGCTTACCGGCGAAGGCGCATCCGCAGA
ATCTATTGAAGATGCGGCGCTGGCGCGCAGTAATGCCCTGGCGGCGCTGCTGGATCACGAAGGCGTGATG
GCAGACATTCGCGGTATCACGCTGTCAAACAGTGCCGTCCTGCGCCTGCAGGTACGGGATGTCGAGCGCG
CGTTATCCGCCCCTCGCCCGGCTGATGCGCTGGCCCCCGAATCCGTCCGCCAGCAACTGGCCGACCTCGA
AGCCCGTGGGGCATTACCGCTGGCGGCGTTTCGCGAAGCGCAGGAAAGCGCAGAACGCCTGCAAGTGTGG
GCGCGTGAGACATTAGGCGATCTGGCTCCAGATTTTTCACGCCTGCGGCAGTTGTTAGCGCTGCTGCCTG
ACGTGGTACAGACAACCACACCGGAAATCCCTCCGTCGCCAGCGCCAGTGCCAGACCCCGCAGGCACGGT
TATGGATAATGCCGTTCCGGCACGGGCAGAGGATGTGCCGCCTGTCAACGCGCCACCCGGTATATCCCTC
CCACACAATGCTGAACCGGGGCCAATTCGCGATCGTAATGATGCGCTGGAGCGCCTGCGGTGCATTCGTC
GCTGGTTTGAGAGCAGTGAACCCAGTAGCCCGACCATCCCACTGTTACGCCAGGCTGAAAGACTGGTGGG
AAAACGGTTCTCGGAGGTGATCAATGAGATCCCGGTGGAGTTGCTGGAGAAGTGGGATGCCCTGGAGTGA
 Primer design