SecReT6
Protein ID: 386590154
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0911
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1051063..1051557 [-]
Producthypothetical protein
NoteTssE
UniProt IDI0A5M3
KEGG IDshb:SU5_0911
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.10E-22, Aligned region: 35..147
Protein Sequence: 164 a.a.     [Download]
>gi|386590154|ref|YP_006086554.1| hypothetical protein SU5_0911 [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MSTSRFTPANHLLPTLFDRLCDNAPYQKIDRDISVTPVQLKEIIRRDLSFLLNTISHEGDIDARRYPQAA
ASVLNYGLPPLAGSFMYEHKWDDISEAIRRAIIRFEPRLNAATLRVTPLLDEARQGSYNTLQFEIRGQIL
TQPYPTEFLVRSALDMELSRITFF
 
Nucleotide Sequence: 495 bp     [Download]
>gi|386589256|ref|NC_017623.1|:c1051557-1051063 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGAGCACGTCTCGTTTTACACCCGCTAACCACCTGCTGCCTACGCTGTTTGATCGGCTGTGTGACAATG
CTCCGTATCAGAAAATTGACCGGGATATCAGCGTCACGCCGGTACAACTGAAGGAGATCATTCGTCGGGA
TCTCTCCTTTTTGCTCAATACCATTAGCCACGAGGGTGACATCGACGCCCGGCGCTATCCGCAGGCGGCG
GCGTCAGTGCTCAACTATGGTCTGCCGCCGCTGGCGGGCAGCTTTATGTATGAGCACAAGTGGGACGATA
TCAGCGAGGCGATCCGGCGCGCCATTATCCGTTTCGAACCCCGGCTGAACGCCGCCACACTCAGGGTCAC
GCCCTTGCTCGATGAAGCCCGGCAGGGTAGCTATAACACGCTACAGTTTGAAATTCGCGGACAAATTCTG
ACGCAGCCGTATCCCACGGAGTTTCTGGTACGCAGCGCGCTGGATATGGAGCTGAGCCGCATTACGTTCT
TTTAA
 Primer design