SecReT6
Protein ID: 386590162
SecReT6 ID621
T6SS typei3
Gene symbol-
Locus tagSU5_0919
StrainSalmonella enterica subsp. enterica serovar Heidelberg str. B182
Repliconchromosome [GenBank: NC_017623] [Browse all T6SS(s) in this replicon]
Location [Strand]1060324..1060809 [+]
ProductType VI secretion system-associated
NoteSTM0277 (e)
UniProt IDI0A5N1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 4.00E-28, Aligned region: 40..141
Protein Sequence: 161 a.a.     [Download]
>gi|386590162|ref|YP_006086562.1| Type VI secretion system-associated [Salmonella enterica subsp. enterica serovar Heidelberg str. B182]
MNRPSFNEAWLAFRKVNHSVADVGSIIGGNVGKNITGSYFQNACPIRMSYVLNATGFPIARNSPYAKVSG
ADNKFYIYRVNDMIDYLTHTMGKPDLIVNNPKQSDFIGKKGIIVVKGHGWSNARGHVTLWNGSICSDQCH
LLNDPDNGPFVPEVGTLWILP
 
Nucleotide Sequence: 486 bp     [Download]
>gi|386589256|ref|NC_017623.1|:1060324-1060809 Salmonella enterica subsp. enterica serovar Heidelberg str. B182 chromosome, complete genome
ATGAACAGACCTTCATTCAATGAAGCGTGGTTAGCTTTTAGGAAGGTGAATCATTCCGTCGCTGATGTGG
GTAGCATTATTGGTGGAAACGTTGGGAAAAATATAACTGGTAGTTATTTTCAAAATGCCTGCCCTATTCG
AATGAGCTATGTTTTGAATGCGACAGGATTCCCAATAGCCCGTAACTCTCCGTATGCAAAGGTTAGTGGT
GCCGATAATAAATTCTATATTTATCGCGTGAATGATATGATTGATTATCTTACTCATACTATGGGCAAGC
CTGATCTTATTGTTAATAATCCGAAACAGAGTGACTTTATAGGGAAGAAAGGAATTATCGTAGTAAAAGG
GCATGGCTGGAGCAATGCCAGAGGACACGTTACATTATGGAATGGCAGTATCTGTTCAGATCAGTGCCAC
TTATTAAATGACCCAGATAATGGACCATTTGTTCCTGAAGTTGGGACTCTGTGGATACTGCCGTGA
 Primer design